KEGG   Mycobacterium bovis AF2122/97: Mb3089Help
Entry
Mb3089            CDS       T00132                                 

Gene name
ligB
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mbo  Mycobacterium bovis AF2122/97
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:mbo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Mb3089 (ligB)
   03410 Base excision repair
    Mb3089 (ligB)
   03420 Nucleotide excision repair
    Mb3089 (ligB)
   03430 Mismatch repair
    Mb3089 (ligB)
Enzymes [BR:mbo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mb3089 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     Mb3089 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Mb3089 (ligB)
DNA replication proteins [BR:mbo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Mb3089 (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Mb3089 (ligB)
DNA repair and recombination proteins [BR:mbo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Mb3089 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     Mb3089 (ligB)
   MMR (mismatch exicision repair)
    Other MMR factors
     Mb3089 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
3382131..3383654
Genome map
AA seq 507 aa AA seqDB search
MLLHDVAITSMDVAATSSRLTKVARIAALLHRAAPDTQLVTIIVSWLSGELPQRHIGVGW
AALRSLPPPAPQPALTVTGVDATLSKIGTLSGKGSQAQRAALVAELFSAATEAEQTFLLR
LLGGELRQGAKGGIMADAVAQAAGLPAATVQRAAMLGGDLAAAAAAGLSGAALDTFTLRV
GRPIGPMLAQTATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARL
PEVVEATLALPVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFF
DILHRDGTDLLEAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMA
KAPAARYLAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGGFVM
VGKTFKGMTDAMLDWQTTRFHEIAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGGLAL
RFARVVRYRADKDPAEADTIDAVRALY
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgctccttcacgacgtggccatcacctcaatggacgtggccgccacctcgtcgcggctg
accaaggtcgcgcgcatcgccgccctgttgcaccgcgccgcgccagacacacagctggtc
acgatcatcgtgtcgtggctctccggcgagctgccgcaacgccatatcggtgtcgggtgg
gcggcattgcggtccctaccgccgcccgcgccgcaaccggcgttgaccgtcaccggtgtc
gacgccaccctctctaagatcggcactctatcgggcaaagggtctcaggcgcagcgcgcg
gcactcgttgcggaattgttctccgccgcaaccgaagctgagcaaacctttttgttgcga
ctgctcggcggtgaactgcgccagggcgcaaagggcgggatcatggccgatgcggtcgcc
caggccgccgggctcccggccgcgacggtccaacgcgccgcgatgctaggcggcgacctg
gcggcagcggcggcggccggcctgtccggcgcggcgctggacaccttcaccctgcgagtg
ggccgaccgataggcccgatgctggcacagaccgcgaccagcgtccatgatgcactcgaa
cgtcacggcggcacaaccattttcgaggctaaactagacggcgcgcgagtgcagatccac
cgggcaaacgaccaggtcaggatctacacccgaagcctggacgacgtcactgcccggctg
cccgaggtggtggaggcaacactggcactgccggtccgggatctagtggccgacggcgag
gcgatcgcgctgtgcccggacaaccggccgcagcgtttccaggtcaccgcatcacggttc
ggccgatcggtcgatgttgcggctgcccgcgcgacgcagccactttcggtgttcttcttc
gacatcctgcatcgggatggtaccgacttgctcgaagcgccgaccaccgagcggctggcc
gccctggacgcactggtgccggctcggcaccgcgtggaccggctgatcacgtccgatcca
acggacgcggccaacttcctggatgcgacgctggccgccggccacgagggggtgatggcc
aaggcaccggccgctcgttaccttgcgggtcgccgcggagcgggctggctgaaggtcaag
ccggtgcacacactcgacttggtggtgctcgcggtggaatggggctcgggacgccggcgc
ggcaagctctccaatattcacctgggcgcacgcgatccggctaccggtggattcgtgatg
gtgggcaagaccttcaaaggaatgaccgacgccatgctggactggcagaccaccaggttt
cacgagatcgcggtgggtccgacagacggctacgtcgtccaacttaggcccgagcaggtg
gtcgaggtagccctcgacggcgtgcaaaggtcgtcgcgctacccgggcgggctggcattg
cggtttgcccgcgtggtgcgctaccgcgccgacaaggacccggccgaggccgacaccatc
gatgccgtgcgcgcgctctactga

DBGET integrated database retrieval system