KEGG   Penicillium rubens: Pc18g00240Help
Entry
Pc18g00240        CDS       T01091                                 

Definition
(RefSeq) Pc18g00240
  KO
K17862  linoleate 10R-lipoxygenase [EC:1.13.11.62]
Organism
pcs  Penicillium rubens
Pathway
pcs00591  Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    Pc18g00240
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.62  linoleate 10R-lipoxygenase
     Pc18g00240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 8315811
NCBI-ProteinID: XP_002561871
UniProt: B6HBN9
LinkDB All DBs
AA seq 1118 aa AA seqDB search
MLKRFSTQFKRSKDSKDPKESNGDAEPKSTDKSSKRASKVSPSPKSTHKEENHVVKRSEV
VAVFDKYAQAIHASQEPLPNQTSDGAYLKHDKSSGLINDIKALGFRDVGTVKDLIASKAS
GGIIDDKTYLMERIIQMVADLPGNSKNRTDLTGLFLDDLWNSIPHPPLSYMGDDYKYRSA
DGSNNNPTLPWLGAANTPYCRTIAPLTIQPSGLPDAGLIFDTLYARQEFTPHPNKVSSVF
FDWASLIIHDIFQTDYSQQHLNQTSAYLDLSILYGDVKEQQDKIRSHENGKLKPDCFSEG
RLQALPPACGVLLVMLNRFHNHIVTQLAAINENGRFSAPRPGLSEEETKAAWAKRDEDLF
QTGRLITCGLYINITLYDYLRTIVNLNRTNSTWCLDPRAQAEKADATPSGLGNQCSVEFN
LAYRWHSTISQGDEKWIEQIYYDLMGKPAEQVSMPELLMGMKKVKGMLEADPAKRTFGHL
QRNADGYFDDGELVNILTRATEDVASSFGPRNVPKAMRSIEILGIEASRRWNVGSLNEFR
KHFGLKPYETFEDVNSNPEIANTLRHLYEHPDYIELYPGIVSEEAKEPMIPGVGIAPTYT
ISRAVLSDAVALVRGDRHYTIDYNPRNLTNWGYNECRYDLNINQGCIFYKLATRAFPNHY
KPDSIYAHYPMTIPSENRNIMKDLGREQDYSWDKPAFMEPRVNLTSHQNAKLLLENQKDF
RPSWARSMSELFGKGEFDTKQREAIGKALNTEEFPKLVKTFYEDITERLIAEKGGQLGKI
NQIDITRDVGNLAHVHFASTIFGVPLKTEDNPRGLFTEHEMYMILSTIFSALFFDVDAPR
SYALNRAASAVSNQLGQVVEATVKADTNSGLFAGIMDNFRPHDNALREFGTEAIRRMKEA
GSSASDITWSAIVPTIVGLVPNQAQVFTQIIEFYTAPENKAHLAEINRFAKTDSAESDEK
LYRYCLEAVRLNGTFGAFREAKETVTVEEDGKTYTVQPGQQVFASFDQANHDPSVFPEPN
EVNLDRPLDSYINHGQGPTTGFGEQVTKIALIAMLRVVGRLQGLRRAPGAQGQLKKIPQE
GGYQVYLRGDGTAYCPFPMSLKLHWDGPFEQKKKVTSS
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagagattctccactcagttcaagcggtccaaggactccaaagaccccaaggag
tccaatggtgatgccgagcctaagagcacagacaagagcagcaagcgcgcctctaaggtc
tcgccatctccgaagtccactcataaggaggagaaccatgtcgtgaagcgttctgaggtg
gttgctgtattcgacaagtatgcgcaagcaattcatgcttcgcaagagcctctgcccaac
caaaccagtgatggcgcctacttgaagcacgacaagtcatccggtctcatcaatgacatc
aaggcgctgggattccgcgatgtcggcactgtcaaagacctgattgcgagcaaagcctcc
ggcggaattattgatgacaagacctatttgatggagcgcataatccagatggtcgcggac
ttgcccggtaactccaagaaccgcaccgacctcaccggtttattcctggatgacctctgg
aactcaattcctcacccgcctctctcttacatgggagatgattacaagtatcgctcggcc
gacggctcaaataacaaccctactctgccgtggctgggagctgctaataccccatactgc
cgcaccattgctcccctgaccatccagcccagcggattgcccgacgccggtctgatcttt
gataccctctatgcccgtcaggagttcaccccgcaccccaacaaggtctccagtgttttc
ttcgactgggcctctctgatcattcacgatatcttccagaccgactacagccaacagcac
ctgaaccagacctctgcttaccttgacttgtccattctgtacggagatgtcaaggaacaa
caggataagatccgttcccacgaaaacggaaagctgaagcccgattgcttctccgaaggt
cgtctgcaggcccttcctcctgcctgcggtgttctgctggttatgctgaaccgtttccat
aaccacattgttacccagctggctgccatcaacgagaatggtcgcttcagcgcaccccgc
cctggtctgtccgaggaggagaccaaggctgcctgggccaagcgtgatgaggacctgttc
cagaccggtcgtcttatcacctgtggtctctacatcaacatcactctgtatgattacctg
cgcaccattgttaacttgaaccgcacaaactccacctggtgtttggatccccgtgcgcag
gctgagaaggccgacgccactccttccggtctcggaaaccagtgctctgtcgagtttaac
ttggcctaccgttggcactcgaccatcagtcagggtgacgagaagtggattgagcagatc
tattacgaccttatgggcaagcctgctgagcaggtcagcatgcctgagctactgatgggt
atgaagaaggttaagggtatgcttgaggctgaccctgccaagcgtaccttcggccacctg
cagcgtaatgcggatggatacttcgatgacggagagcttgtcaacattctgactcgtgct
accgaggatgtggccagctctttcggtccccgaaacgtacccaaggccatgcgctctatc
gagatcctcggaatcgaggcttcgcgtagatggaacgtcggttctctcaatgagttccgt
aagcacttcggcctgaagccttacgagactttcgaagacgtcaactccaaccccgagatc
gctaatactctccgtcacctctacgagcaccccgattacattgagctgtaccccggtatc
gtctccgaggaggctaaggagcccatgatccctggtgtcggtatcgccccgacctacacc
atctcccgtgctgtgctgtcggatgccgtcgcccttgtccgtggtgaccgtcactacact
attgactacaacccccgtaacctgaccaactggggttacaatgagtgccgttacgacctc
aacatcaaccagggctgtatcttctataagctggccacgcgcgccttccccaaccactac
aagcctgactccatctacgcccactaccctatgaccatccccagcgagaaccgcaacatc
atgaaggatctgggccgtgagcaggattactcctgggacaaacccgccttcatggagcct
cgtgtcaatctgacctcccaccagaatgccaagctgctcctcgagaaccagaaggacttc
cgtcccagctgggcccgctccatgtctgaactcttcggcaagggcgagttcgatacgaag
cagcgcgaggctatcggcaaggctctcaacaccgaggagttccccaagctcgtcaagacc
ttctacgaagatatcactgagcgcttgattgctgagaagggtggccagttgggcaagatc
aaccagatcgatatcactcgtgatgtcggtaacctggcccacgtccacttcgcctctact
atcttcggcgttcccctgaagaccgaggataacccgcggggactcttcaccgagcacgag
atgtacatgatcctttccaccatcttctccgcgctcttcttcgacgtcgacgctcctcgc
tcgtacgctctgaaccgcgccgcctccgccgtctccaaccagctcggtcaggtcgtcgag
gccactgtcaaggcggacaccaacagcggtctcttcgccggcatcatggacaacttccgt
ccccatgacaacgctctccgggagttcggaacagaagctatccgccgcatgaaggaggca
ggctccagcgcctctgacattacctggtccgctattgtcccgacaatcgtcggccttgtc
cccaaccaggctcaggtcttcacccagatcatcgagttctacactgcgcccgagaacaag
gcccacctggctgagatcaaccgcttcgccaagaccgattccgccgaatcggacgagaag
ctctaccgctactgcctggaggccgttcgtctgaacggcaccttcggcgccttccgcgag
gccaaggaaaccgtcaccgtcgaggaagacggcaagacctacaccgtccagcccgggcag
caggtcttcgcctcctttgaccaggccaaccacgaccccagcgttttccctgagcccaac
gaggtcaaccttgaccgccctcttgactcgtatatcaaccacggccagggtcccaccacc
ggcttcggcgagcaggtcactaagatcgcgctcattgctatgctgcgtgtcgtcggtcgt
ttgcagggtctccgtcgtgctcctggcgcccagggccagcttaagaagattccccaggag
ggtggctaccaagtttacctccgcggtgacggaactgcctactgtcccttcccgatgtcg
cttaagctgcactgggatggtccattcgagcaaaagaagaaggttacatcttcctga

DBGET integrated database retrieval system