KEGG   Penicillium rubens: Pc21g16940Help
Entry
Pc21g16940        CDS       T01091                                 

Definition
(RefSeq) Pc21g16940
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pcs  Penicillium rubens
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Pc21g16940
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Pc21g16940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 154 aa AA seqDB search
MVKAVAVLRGDAKVAGTVTFEQANESAPTTISWNITGHDANAERAFHVHQFGDNTNGCTS
AGPHFNPFGKTHGAPTDSERHVGDLGNFKTDAEGNSNGSKQDELIKLIGAESVLGRTLVV
HAGTDDLGKGGNEESKKTGNAGPRPACGVIGIAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggctgttgctgtcctccgtggtgacgctaaggtcgccggtaccgttaccttc
gagcaggctaacgagagtgcccccaccaccatctcctggaacatcaccggccacgacgcc
aacgctgagcgtgctttccacgttcaccagttcggtgacaacaccaacggctgcacctct
gctggtccccacttcaaccccttcggcaagacccacggtgctcccactgactccgagcgt
cacgttggtgaccttggcaacttcaagaccgatgccgagggtaactccaacggctccaag
caggatgagcttatcaagctgattggtgccgagtccgttctgggccgcactctcgtcgtc
cacgccggtactgatgaccttggcaagggtggtaacgaggagtccaagaagaccggtaac
gctggcccccgccctgcttgcggtgtcatcggtattgccgcataa

DBGET integrated database retrieval system