KEGG   Penicillium rubens: Pc22g23550Help
Entry
Pc22g23550        CDS       T01091                                 

Definition
(RefSeq) Pc22g23550
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
pcs  Penicillium rubens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pc22g23550
   00051 Fructose and mannose metabolism
    Pc22g23550
   00052 Galactose metabolism
    Pc22g23550
   00500 Starch and sucrose metabolism
    Pc22g23550
   00520 Amino sugar and nucleotide sugar metabolism
    Pc22g23550
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pc22g23550
Enzymes [BR:pcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Pc22g23550
Membrane trafficking [BR:pcs04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Pc22g23550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 494 aa AA seqDB search
MSSSLLDQATRIARDFDYPAEKVQRGVAEYIKQSNEGLTKEGTTLSQIPTFVTAVPNGTE
KGLYLAVDLGGTNFRVCSVLLHGDTTFSLTQSKILIPRELMASGTSKDLFLFLARQIEAF
LRIHHNEHFEAHLLRRREGNTEEDLFDLGFTFSFPVRQCGINRGTLIRWTKGFNIPDAVG
HDVCALLQSAIDELSLPVRVAALVNDTVGTLMARSYTSPGETGTFIGAIFGTGTNGAYVE
KTKNITKLQHMKDAHFEDSTGEMIINAEWGSFDNHMSVLPTTVFDDELDADSNNPGVQMF
EKRVSGMFLGEILRRALLSLYRADLGLFQANKDSKVVLPEGSMLFRQWGLDTSMLSSVEA
DTSEDLVDVKTALKDHLEIENPSLEECQAVKTIVHAIGKRAARLSAVPLAAIVVHSNKLQ
TDDMIDIGVDGSLVEFYPNFEGHLREALREVPEVGAAGDKRIRIGISKDGSGVGAALIAL
VANKTEGFEIPREN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttcactattggaccaagctacgcgcattgcgcgtgacttcgactaccccgcc
gagaaagtgcagcgcggggttgccgagtacatcaagcagtctaacgagggcttgaccaaa
gagggcaccaccttgagccaaatccctactttcgtgactgcggtgccaaatggcacagaa
aagggtctttacttggctgttgatctcggtggcactaacttccgtgtgtgctcggtcctc
ctgcacggcgacaccaccttctccctcacccagtccaagatcttaattcctcgggaattg
atggcctctggcacatcaaaggatctcttcctgttcttggcccgtcaaatcgaggcattc
cttcgcattcaccacaacgaacacttcgaggcccacctgctccgccgacgggagggtaac
accgaagaggacctgttcgatctgggctttaccttcagtttccctgtgcgccagtgtggg
atcaaccgcggaacacttatccgctggaccaagggcttcaatatccccgatgcggttggt
cacgatgtttgcgcgctgcttcagtccgccattgatgagttgagcctgccagtgcgcgtg
gctgcgttagtgaacgacaccgtcggtactctcatggcccgctcatacacctcgccaggc
gagactggcactttcattggtgccattttcggaaccggtaccaacggtgcttacgtggag
aagaccaagaacatcaccaagctccagcatatgaaggatgcccactttgaagactccaca
ggcgagatgattatcaacgctgagtggggtagcttcgacaaccacatgagcgttctccct
accaccgtgttcgacgatgagctcgatgccgacagcaacaaccccggtgtgcagatgttc
gaaaaacgtgtttcaggcatgttcttgggcgaaattctccgccgcgcgctcctgtctctc
taccgtgccgacctgggactgttccaggccaacaaggactccaaggtcgtccttcctgaa
ggatccatgcttttccgtcaatggggtcttgacaccagcatgctgagttcagtcgaagct
gataccagcgaggacttggtggatgtgaagactgcattgaaggatcacctcgagattgag
aaccccagcctcgaagagtgccaggctgtgaaaaccatagttcacgccattgggaaacgt
gccgctcgcctgagcgctgtcccgttggctgctattgtcgtgcacagtaacaagcttcag
actgatgatatgattgacattggtgtcgatggcagcctcgttgaattctaccccaacttt
gaagggcatttgcgtgaggctttgcgcgaagttcccgaagttggagctgcaggcgacaag
aggatccgtattggcatttccaaggatggcagcggtgttggcgcagctctgattgcgctc
gtcgctaacaagaccgagggctttgaaattccccgcgagaactaa

DBGET integrated database retrieval system