KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_127975Help
Entry
PHYPADRAFT_127975 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PHYPADRAFT_127975
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHYPADRAFT_127975
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHYPADRAFT_127975
   00430 Taurine and hypotaurine metabolism
    PHYPADRAFT_127975
Enzymes [BR:ppp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PHYPADRAFT_127975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 518 aa AA seqDB search
MKETRGHNTIDSMFASRYVQCELPKFTIPERATPKDAAYQIISDELMLDGNPRLNLASFV
TTWMEPECDKLIMSALNKNYIDMDEYPITTELQDRCVNMVARLFNAPIEEGEQAIGAGTV
GSSEAIMLAGLAFKRKWQNERKAAGKPWDKPNLVTGANVQVCWEKFARYFEVELREVKLK
EDYYVMDPYKAVELVDENTICVCAILGSTYNGEFEDVQLLNDLLEEKNREKGLHVPIHVD
AASGGFIAPFLYPDIVWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRSKEDLPEELVFHV
NYLGADQPTFTLNFSKGASQVIAQYYQLIRLGFEGYKNIMANCAMNAKILTKAIESTGRF
KILSKEVGVPVVAFSLLDNSDHNEYEISHQLRHYGWTVPAYTMAADAQHVTLLRVVVRED
FSRSLSDRLLTDIKRVLAYFDARPSKLIEAVTAAVVEENKEQHLEMPTTPDAVKATQAFN
TVILEHVACKKKHNGHHHSRSRGGHGKKHASPKANGVC
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagacgcggggtcacaacaccattgactccatgtttgcttccagatatgtccag
tgcgagcttcccaagttcaccattcccgagcgggcaacacccaaggatgccgcgtaccag
atcatcagcgacgagctcatgttggatggcaaccctcgcttgaatttggcgtccttcgtg
acgacatggatggagcctgagtgtgataagctcattatgtctgcgctcaacaagaactac
attgacatggacgagtacccaattaccaccgagcttcaggaccgatgcgtgaacatggtg
gctcgtttgttcaatgcacctattgaggaaggtgaacaagctatcggagctggtacagtg
ggatcctcagaagcaatcatgcttgctggtctcgcattcaagaggaaatggcagaacgag
cggaaagcagctggaaagccttgggacaagcccaatctggtcacgggtgccaatgttcag
gtctgctgggagaagtttgcaagatatttcgaagtggagctacgcgaggtgaagctcaaa
gaagactattacgtcatggatccctacaaagcagtggagctcgttgacgagaacacgatt
tgtgtgtgtgctatcctcggatccacatacaatggcgagttcgaagacgtgcagctgctg
aatgatctgctggaggagaagaaccgggagaaagggttgcacgttcctattcacgtcgat
gccgcaagtggaggcttcatagctcctttcctttatcccgacattgtgtgggacttccga
ctcccacttgtgaagagtatcaacgtgagcgggcacaagtatggtctagtgtacgctggc
attggctgggtcgtgtggaggagcaaggaggatttgcccgaagagcttgtgtttcatgtc
aattatctcggcgcagaccagcctacattcacgttgaatttctccaaaggagcgagtcaa
gtcatcgctcagtactatcagctcatccgtctgggattcgaaggatacaagaacattatg
gcgaactgcgccatgaacgccaagatacttacaaaggcgattgagagcactggtcgattc
aagatcttgtcgaaggaagtcggcgtccccgtggtggcattctcccttttggacaactcc
gatcacaacgagtatgagatctcacaccagcttcgccactacggctggaccgtgccggcg
tacacgatggcggccgacgcgcaacacgtcacgcttctccgcgtcgtcgtgcgggaagat
tttagcagatctttgtcagaccgtctcttgaccgacatcaagcgcgtgctggcctacttt
gacgcccgcccttccaagctcatcgaggctgtgaccgcggcggtcgtggaagagaacaaa
gagcagcacctggagatgccaacaacgcccgacgcagtgaaagccacgcaagcattcaac
accgtgatcctcgaacacgttgcatgcaagaagaagcacaacggccaccaccacagccgc
agcagagggggccatggcaagaaacatgcttcccccaaggccaacggcgtttgttaa

DBGET integrated database retrieval system