KEGG   Pan troglodytes (chimpanzee): 100608629Help
Entry
100608629         CDS       T01005                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  
succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100608629 (SDHA)
  Energy metabolism
   00190 Oxidative phosphorylation
    100608629 (SDHA)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100608629 (SDHA)
   05012 Parkinson's disease
    100608629 (SDHA)
   05016 Huntington's disease
    100608629 (SDHA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100608629 (SDHA)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100608629 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 664 aa AA seqDB search
MSRVRGLSRLLSARRLALAKAWPAVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCGKIS
KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGVHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgggtccggggcctgtcgcggctgctgagcgctcggcgcctggcgctggccaag
gcgtggccagcagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatacagcatgtgttaccaagctgtttcctaccaggtcacacact
gttgcagcgcagggaggaatcaatgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccac
tacatgacggagcaggcccccgccgccgtggtcgagctagaaaattatggcatgccgttt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggactggccactcgcta
ttgcacaccttatatggaaggtctctgcgatatgataccagctattttgtggagtatttt
gccttggatctcctgatggagaacggggagtgccgtggtgtcatcgcactgtgcatagag
gacgggtccatccatcgcataagagcaaagaacactgttgttgccacaggaggctacggg
cgcacctacttcagctgcacgtctgcccacaccagcactggcgacggcacggccatgatc
accagggcaggccttccttgccaggacctcgagtttgttcagttccaccccacaggcata
tatggtgctggttgtctcattacggaaggatgtcgtggagagggaggcattctcattaac
agtcaaggcgaaaggtttatggagcgatacgcccctgtcgcgaaggacctggcgtctaga
gatgtggtgtctcggtcgatgactctggagatccgagaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagctgcaccacctacctccagagcagctggccacgcgcctg
cctggcatttcagagacagccatgatcttcgctggcgtggacgtcacgaaggagccgatc
cctgtcctccccaccgtgcattataacatgggcggcattcccaccaactacaaggggcag
gtcctgaggcacgtgaatggccaggatcagattgtgcctggcctgtacgcctgtggggag
gccgcctgtgcctcggtacatggtgccaaccgccttggggcaaactcgctcttggacctg
gttgtctttggtcgggcatgtgccctgagcatcgaagagtcatgcaggcctggagataaa
gtccctccaattaaaccaaacgctggggaagaatctgtcatgaatcttgacaaattgaga
tttgctgatggaagcataagaacatcggaactgcgactcaacatgcagaagtcaatgcaa
aatcatgctgccgtgttccgtgtgggaagcgtgttgcaagaaggttgtgggaaaatcagc
aagctctatggagacctaaagcacctgaagacgttcgaccggggaatggtctggaacacg
gacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagaccatctac
ggagcagaggcgcggaaggagtcacggggcgtgcatgccagggaagactacaaggtgcgg
attgatgagtacgattactccaagcccatccaggggcaacagaagaagccctttgaggag
cactggagaaagcacaccctgtcgtatgtggacgttggcactgggaaggtcactctggaa
tatagacccgtaatcgacaaaactttgaacgaggctgactgtgccaccgtcccgccagcc
attcgctcctactga

DBGET integrated database retrieval system