KEGG   Plasmodium yoelii: PY05303Help
Entry
PY05303           CDS       T01035                                 

Definition
(RefSeq) FAD-dependent glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pyo  Plasmodium yoelii
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PY05303
Enzymes [BR:pyo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PY05303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 625 aa AA seqDB search
MLKKALVGAGGLGMISVGGVYLLKVNFHKNMIDKDVTYKYSPIGNRSEMINRLKTNQYDI
LIIGGGATGAGLALDCATRGIRCALIDRNDFSSGTSSKSTKLLHGGIRYLENAVKKLDIS
ELYFVWEALGERAHAMKIAPFMSRPVPILMPIYKLWQVPYFAYNIKIYDLLADLVCYFDK
GVPNSMYIQKQNTLDQFPLLHQDELKGSLVYYDGQHNDARMNLNLVLTSAIDNYVPGQVG
ATICNHMEVISFIMDENNKKIIGVRALDKINNKEIEIYAKVIINATGPQGDIIRKMADEN
SKPMIQVSVGCHFILPKWYSSKNNGMIIPKTSDGRVLFLLPWENNTIVGTTDEQRPLVDN
PKIAKKDTEFLATELSKYINVSPEEIKNDIKAAWCGFRPLVHDSKKQKKQKNNNDQDEIT
THEISRSHEIIEDENGLISILGGKWTIYRKMAQDTLDYVLSKHSDKIQNKNECRTKFLML
IGSHDQNGNLNHEDLTFGCSKLGKKLVDTYSEIDYETANYLVSNYGYLSEKVCELAKELK
LFNKIDQTKPYIEAEIVYASRYEFANTISDVIGRRFRLGFIDTHVSNQVIHKIANLLKDE
LNWSKDQMNKNIEEAKSYIDSLSLE
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaggctctggttggagcgggagggctcggcatgatatccgttggaggcgtt
tacctacttaaggtaaactttcacaaaaatatgattgataaggatgtaacatacaagtat
agtccaattggtaatagatctgaaatgataaacagactaaaaacaaatcagtatgatata
ttaataattggtggaggagcaaccggggcaggtttagctttagattgtgcaacaagagga
ataagatgtgcactaattgacagaaacgatttttcaagtggaacttcttcaaaatcgact
aaattattacatggtggtattagatatttagaaaatgcagtaaagaaattagatatatca
gaattatattttgtttgggaagctttaggtgaaagagcccatgcaatgaaaattgcaccg
tttatgtctcgacctgttccgatattaatgcctatatataaattatggcaagttccttat
tttgcatataatataaaaatatatgatttattagctgatttagtttgttattttgataag
ggagtacccaattctatgtatatacaaaaacaaaacacattagatcaatttcctttgtta
catcaagatgaattaaaaggatctttggtatattatgatgggcaacataatgatgcacga
atgaatttaaatttagtattaacaagtgctatagataattatgtaccgggacaagtcgga
gctactatatgtaaccacatggaagttataagttttataatggatgaaaataataaaaaa
ataataggtgttagagctttagataaaattaataataaagaaattgaaatatatgcaaaa
gttattattaatgctacaggaccacaaggagatattattagaaaaatggcagatgaaaat
agtaaacccatgattcaagtatctgttggatgtcattttattttacctaaatggtattca
tctaaaaataatggaatgataatacctaaaacaagtgatggtagagtattatttttattg
ccttgggaaaataatacaattgttggaacgacagatgaacaacgacctttagtagataat
cccaaaattgctaaaaaagataccgaatttttagcaactgaattatctaaatatattaat
gtttctccagaagaaataaaaaatgatattaaagctgcttggtgtggatttcgaccttta
gttcatgattcaaaaaaacaaaaaaaacaaaaaaataataatgatcaagatgaaattaca
acacatgaaatatcaagaagtcatgaaattattgaagatgaaaatgggctaattagtata
ttaggtggaaaatggactatatatagaaaaatggctcaagatacacttgattatgtttta
tctaaacatagtgataagatacaaaataaaaatgaatgtagaactaaatttttaatgtta
attggtagtcatgatcaaaatggaaatttaaatcacgaagatttaacatttggatgtagt
aaattaggaaaaaaacttgttgatacatattcagaaattgattatgaaacagctaattat
ttagtatcaaattatggttatttatctgaaaaagtttgtgaattagcaaaagaattaaaa
ctatttaacaaaattgatcaaacaaaaccatatatagaagctgaaattgtatatgcaagt
agatatgaatttgctaatactatttccgatgttattggaagaaggtttagattagggttt
attgatacacatgtttcaaatcaagttatacataaaattgctaatttattaaaagatgaa
ttaaattggtctaaagatcaaatgaacaaaaatatcgaagaagccaaatcatatatcgat
tcattatctttagaataa

DBGET integrated database retrieval system