KEGG   Streptomyces avermitilis: SAV_1842Help
Entry
SAV_1842          CDS       T00126                                 

Gene name
neuA1
Definition
(GenBank) putative neuraminidase, secreted
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sma  Streptomyces avermitilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SAV_1842 (neuA1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAV_1842 (neuA1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SAV_1842 (neuA1)
Bacterial toxins [BR:sma02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SAV_1842 (neuA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
2256926..2258803
Genome map
AA seq 625 aa AA seqDB search
MPSTLRARIASTLTAVLTTAALLALPSPAGAEQATDTGEFEQQVLFKASQDPGYACFRIP
AVVKTTDGTLLAFAEGRVLNCGDAADIDIVLKRSTDGGRTWGPLQVVNEGGGDTHGNPAP
VVDRETGRIVLAETYNTGRTDSAGCTVPCDRTPHLQYSDDDGLTWSRPRDLSDEILPPEW
NSWYATGPVHGIQLTRGRHAGRLVLGVNTETWDGSRVSANHAALITSDDGGDHWRIGATD
SWPIAADGTFRQKPSEMTLAERTDGSVLVSGREQDGTDLGHRTQAVSRDGGSSFTAPFRD
LPDLYTPQVQGSSLRLGDRLLLACPGDPDRRRTMTIRSSYDGGRTWDSVDRGTVVTTDWS
GYSDLVRVGRDTVGLMYEGGAVDARDEIRFARFTEDWLKPRRGPDPTTPDLAPHAKGAAV
LGGAEQTEGVFGGALDFDGADDAVRLPYRAELPLGTKDFTASLWFRYTAATGEQPLLWMG
GIGTSQPQVWLRGEPASNRVQGLITVRDGASAPQSAFVRTTGAYNDGQWHHLALRRGGGA
LTLFLDGTPISTADVPGSVSRNSPFGVHIGQRMDSRAYFTGSIDEVRVYGRALSDAEITG
LRTDNEASARDTVLRLPMDRVSGSH
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcaactctccgtgcacgtatcgcatcgaccctgaccgccgtgctcaccaccgcc
gcactactggccctgccgagccccgcgggggccgaacaggcgacggacacgggtgagttc
gagcaacaggtgctcttcaaggcgtcccaggatcccggatacgcctgcttccgcataccg
gccgtcgtgaagacgaccgacggcaccctcctggcgttcgccgagggccgcgtcctcaac
tgcggtgacgcggccgacatcgacatcgtcctcaagcgctccaccgacggcggccgcacc
tggggcccgctccaggtggtcaacgagggcggcggggacacccacggcaacccggcgccc
gtagtggaccgcgagaccggccgcatcgtcctggccgagacgtacaacacgggccgtacg
gacagcgccggctgtaccgtcccgtgcgaccgcacaccgcacctccagtacagcgacgac
gacggcctcacctggtcccggccgcgcgacctgagcgacgagatcctcccgccggagtgg
aactcctggtacgccaccggacccgtgcacggcatccagctgacccggggcagacatgcg
ggccggctcgtcctcggcgtcaacaccgagacatgggacggcagtcgggtcagcgcgaac
cacgccgcgctcatcaccagcgacgacggcggcgaccactggaggatcggcgccacggac
tcgtggccgatcgccgcggacggcacgttccgtcagaagccgtccgagatgacgctggcc
gagcgcacggacgggtccgtcctggtcagcgggcgcgagcaggacggcaccgacctcgga
caccgcacccaggccgtcagccgcgacggcggctccagcttcaccgcgcccttccgtgat
ctgccggacctgtacacgccccaggtccagggctcctcgctgcgcctgggcgaccggctg
ctgctcgcctgccccggcgacccggaccgccggcggaccatgacgatccgctcctcgtac
gacggcggacgcacctgggacagcgtcgaccgcggcacggtcgtcaccacggactggtcg
ggctactcggacctggtgcgcgtcggccgggacaccgtgggcctgatgtacgagggcggt
gcggtcgacgcgcgggacgagatccgcttcgcccgcttcaccgaggactggctgaaaccc
cgccgcggccccgacccgacaacgcccgacctggccccgcacgccaagggcgccgcggtc
ctcgggggcgccgagcagacggagggcgtgttcggcggcgcgctcgacttcgacggcgcc
gacgacgccgtacgcctgccgtaccgtgccgaactcccgctcgggacaaaggacttcacg
gcgtccctctggttccgttacaccgccgcgaccggcgagcagcccctgctgtggatgggc
gggatcgggacctcgcagccacaggtgtggctgcgcggcgagcccgcgtcgaaccgcgtc
cagggtctgatcaccgtccgcgacggcgcctcggccccgcagtccgcgttcgtgcgcacg
acgggcgcgtacaacgacggccagtggcaccatctcgcgctgcgccgtggcggcggagcg
ctcacgctgttcctcgacggtacgccgatcagcaccgcggatgtgcccgggtccgtcagc
cgcaactcgccgttcggtgtgcacatcggtcagcggatggacagccgggcgtacttcacc
ggatccatcgacgaagtgcgcgtctatggacgggcgttgagcgacgccgagatcacgggc
ctgcgcacggacaacgaggcgtcggcccgggacaccgtcctgcggctgcccatggaccgg
gtgagcggcagccactaa

DBGET integrated database retrieval system