KEGG   Streptomyces avermitilis: SAV_2972Help
Entry
SAV_2972          CDS       T00126                                 

Gene name
sucA
Definition
(GenBank) putative 2-oxoglutarate dehydrogenase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sma  Streptomyces avermitilis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAV_2972 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    SAV_2972 (sucA)
   00380 Tryptophan metabolism
    SAV_2972 (sucA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SAV_2972 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
3724011..3727841
Genome map
AA seq 1276 aa AA seqDB search
MSPQSPSNSSISTDDQAGKNPAAAFGPNEWLVDEIYQQYLQDPNSVDRAWWDFFADYKPG
AAAASAPAGTAAAGAAETTTPAPAAPTAAAPAAPAAPAPAAPAPAPAAPAPAAAPAVPKP
AAAAPAPAAAKPAAAAPAQPKAAAATEAAEGPTFVPLRGPAAAVAKNMNASIEVPTATSV
RAVPVKLLFDNRIVINNHLKRARGGKISFTHLIGYAMVQAIKAMPSMNWHYAEKDGKPTL
VKPAHVNFGLAIDLVKPNGDRQLVVAGIKKAETLNFFEFWQAYEDIVRRARDGKLTMDDF
TGVTVSLTNPGGLGTVHSVPRLMPGQSVIMGVGSMDYPAEFQGTSQDTLNKLGISKVMTL
TSTYDHRVIQGAASGEFLRIVANFLLGEGGFYDEIFEALRIPYEPVRWLKDIDASHDDDV
TKAARVFELIHSYRVRGHVMADTDPLEYRQRKHPDLDITEHGLTLWDLEREFAVGGFAGK
SLMKLRDILGVLRDSYCRTTGIEFMHIQDPKQRKWIQDRIERSHSKPEREEQLRILRRLN
AAEAFETFLQTKYVGQKRFSLEGGESVIPLLDAVIDSAAESRLDEVVIGMAHRGRLNVLA
NIVGKSYAQIFREFEGNLDPKSMHGSGDVKYHLGASGTFTGLDGEQIKVSLAANPSHLET
VDPIIEGIARAKQDIINKGGTDFTVLPVALHGDAAFAGQGVVAETLNMSQLRGYRTGGTV
HIVINNQVGFTAAPESSRSSMYATDVARMIEAPIFHVNGDDPEAVVRVARLAFEFRQAFN
KDVVIDLICYRRRGHNESDNPAFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLEEAEQA
LQDFQGQLEKVFTEVREAISTPGEAPAPEPQPEFPVAVPTAVSQEVVKRIAESQVNIPDH
VTVHPRLLPQLQRRAAMIEDDTIDWGMGETLAIGSLLLEGTPVRLSGQDSRRGTFGQRHA
VLIDRVTGEDFTPLQYLADDQARLNVYDSLLSEYAVMGFEYGYSLARPDALVMWEAQFGD
FVNGAQTVVDEYISAAEQKWGQTSGVTLLLPHGYEGQGPDHSSARIERFLQLCAQNNMTV
AQPTLPSNYFHLLRWQVHNPHHKPLVVFTPKSMLRLKAAASKTEEFTTGAFRPVIGDDTV
DAAAVRKVVFCAGKLYYDLEAERKKRGATDAAAAETAIIRLERLYPLPGAELQAEIAKYP
NAEKYLWAQEEPANQGAWPFIALNLIDHLDLAVGADVPHGERLRRISRPHSSSPAVGSAK
RHQAEQEQLVREVFEA
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccacagtcccccagtaactcgagcatctcgaccgacgaccaagccgggaagaac
cccgctgcggccttcggacccaacgagtggctcgtcgacgagatctatcagcagtacctc
caggacccgaattcggtagaccgagcctggtgggacttcttcgccgattacaagccgggc
gcagctgccgcctcggctccggcgggtactgcggccgcgggggccgcagagaccaccacg
ccggctccggccgcgccgaccgctgcggcccccgccgctcccgcggcaccggctccggcc
gccccggcaccggctccggccgctccggctcccgcggccgctccggcggtcccgaagccc
gctgccgcggctccggccccggccgccgcgaagccggccgccgccgcgcccgcccagccg
aaggccgccgcggcgaccgaggccgccgagggccccacgttcgtcccgctgcgcggtccc
gccgccgcggtcgcgaagaacatgaacgcctcgatcgaggtgcccacggccacgtccgtg
cgcgcggtcccggtgaagctgctcttcgacaaccgcatcgtcatcaacaaccacctgaag
cgtgcccggggcgggaagatctccttcacccacctcatcgggtacgcgatggtgcaggcc
atcaaggccatgccgtcgatgaactggcactacgcggagaaggacgggaagcccaccctc
gtcaagcccgcgcacgtcaacttcggcctcgccatcgacctggtgaagcccaacggcgac
cgccagctcgtcgtcgccggcatcaagaaggccgagacgctgaacttcttcgagttctgg
caggcctacgaggacatcgtccgccgcgcccgtgacggcaagctgacgatggacgacttc
accggtgtcacggtctccctgaccaaccccggcggcctcggcaccgtccactcggtcccg
cgtctgatgcccggccagtcggtcatcatgggcgtcggctccatggactacccggcggag
ttccagggcacctcccaggacaccctgaacaagctcggcatctcgaaggtcatgacgctc
acgtcgacctacgaccaccgggtgatccagggcgccgcgtccggcgagttcctgcggatc
gtcgcgaacttcctcctcggcgagggcggcttctacgacgagatcttcgaggctctgcgg
atcccctacgagccggtccgctggctcaaggacatcgacgcctcgcacgacgacgacgtc
acgaaggccgcccgcgtcttcgagctgatccactcctaccgggtccgcggccacgtcatg
gccgacaccgacccgctggagtaccgccagcgcaagcaccccgacctggacatcaccgag
cacggcctcacgctctgggacctggagcgcgagttcgcggtcggcggcttcgcgggcaag
tccctgatgaagctgcgcgacatcctcggcgtgctgcgcgactcgtactgccgcaccacc
ggcatcgagttcatgcacatccaggaccccaagcagcgcaagtggatccaggaccgcatc
gagcgctcgcactccaagccggagcgcgaggagcagctgcgcatcctgcgccgcctgaac
gcggcggaggccttcgagaccttcctccagacgaagtacgtcggccagaagcgcttctcc
ctggagggcggcgagtccgtcatcccgctgctggacgcggtcatcgactccgccgccgag
tcccgcctggacgaggtcgtcatcggcatggcccaccgcggccgcctgaacgtgctcgcc
aacatcgtcggcaagtcgtacgcgcagatcttccgcgagttcgagggcaacctcgacccg
aagtcgatgcacggctccggcgacgtgaagtaccacctgggcgccagcggcaccttcacc
ggcctggacggcgagcagatcaaggtctcgctggccgccaacccgtcccacctggagacg
gtcgacccgatcatcgagggcatcgcccgcgccaagcaggacatcatcaacaagggcggc
acggacttcacggtcctgccggtcgccctgcacggtgacgcggccttcgcgggccagggc
gtggtggccgagaccctgaacatgtcgcagctgcgcggttaccgcacgggcggcacggtc
cacatcgtcatcaacaaccaggtcggcttcacggccgccccggagtcgtcgcgttcgtcg
atgtacgcgaccgatgtggcccgcatgatcgaggcgccgatcttccacgtgaacggcgac
gaccccgaggccgtcgtccgcgtcgcccgcctggccttcgagttccgccaggcgttcaac
aaggacgtcgtcatcgacctgatctgctaccgccgtcggggccacaacgagtccgacaac
ccggcgttcacgcagcccctgatgtacgacctgatcgacaagaagcgctcggtgcgcaag
ctctacaccgagtccctgatcggccggggcgacatcacgctggaagaggcggagcaggcg
ctccaggacttccagggccagctggagaaggtcttcaccgaggtccgcgaggccatctcc
accccgggcgaggcgccggctcccgagccgcagcccgagttcccggtggccgtgccgacc
gcggtctcccaggaggtcgtgaagcggatcgccgagtcccaggtcaacatccccgaccac
gtcaccgtgcacccgcggctgctgccgcagcttcagcgccgtgcggcgatgatcgaggac
gacacgatcgactggggcatgggcgagaccctggccatcggctcgctgctcctcgagggc
accccggtccgtctttcgggccaggactcccgccggggcacgttcggccagcgccacgcc
gtcctgatcgaccgggtcacgggcgaggacttcaccccgctccagtacctcgcggacgac
caggcgcgcctgaacgtctacgactccctgctctccgagtacgcggtcatgggcttcgag
tacggctactcgctggcccgccccgacgccctcgtgatgtgggaggcgcagttcggtgac
ttcgtcaacggcgcgcagacggtcgtcgacgagtacatctcggccgccgagcagaagtgg
ggccagacgtccggcgtcaccctgctcctcccgcacggctacgagggccagggtccggac
cactcctcggcccgtatcgagcgcttcctccagctgtgcgcgcagaacaacatgacggtc
gcccagccgacgctcccgtcgaactacttccacctcctgcggtggcaggtgcacaacccg
caccacaagccgctggtggtcttcaccccgaagtcgatgctgcgcctcaaggccgccgcc
tcgaagacggaggagttcaccacgggcgccttccgccccgtcatcggcgacgacaccgtc
gacgccgccgcggtccgcaaggtcgtcttctgcgccggcaagctgtactacgacctcgag
gccgagcggaagaagcgcggcgccacggacgcagcggctgccgagaccgcgatcatccgc
ctcgagcgcctgtacccgctgccgggtgccgagctccaggcggagatcgccaagtacccg
aacgccgagaagtacctgtgggcccaggaggagccggcgaaccagggcgcatggcccttc
atcgccctcaacctgatcgaccacctggacctggcggtcggcgcggacgttccgcacggg
gagcgactgcggcgcatctcccgcccgcacagctcttcgccggccgtgggttccgccaag
cggcaccaggctgagcaggagcagttggtgcgagaggtgttcgaggcgtag

DBGET integrated database retrieval system