KEGG   Takifugu rubripes (torafugu): 101075077Help
Entry
101075077         CDS       T02386                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B-A-like
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101075077
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101075077
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101075077
   HMT complexes
    COMPASS/SET1 complex
     101075077
    COMPASS/SET1 complex (yeast)
     101075077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 Mem_trans
Motif
Other DBs
NCBI-GeneID: 101075077
NCBI-ProteinID: XP_011603177
LinkDB All DBs
Position
6
AA seq 1704 aa AA seqDB search
MSKPGERNRLNEDHGRKQSSSLANGMDSHPVCGSAEKRSHHWRSYKLIIDPALKKGSHKL
YRYDGHTFSMPNPGIPPVEMVRDPRIGRLWTKYKETDLPVPKFKIDECYIGPVPPKEVTF
ARLNDNIREGFLTDMCKKFGDIEEVEILYNPKNKKHLGVAKVVFESVKAAKVAVQSLHET
SVMGNIIHVELDPKGENRQRYYQLLMNGSYTPRTLPVGEEAREVSPRSLAEALLACEPIR
RLSESNLTAVERGLPPSSSTTPVSLETGYSSLRQETPQSQGTPHTPRQAGTPFSQDSNYS
SRQSTPAYQSSRPESSGGYKSRRHESKFQDAYNRRPERPQYRSNMYRSSTSEQAPFXQHQ
LTPPEPPPSTPSFTYTAPPPATPNFKSTFSPYQAPLPPAFPPSEPVFHHPAQREDDYPRP
PQPPQAAAPDYLPTKERPETPPTPEPPPPEPAPHPNTPPPQTPEHCPSPGSPTHDPERNS
LDSRIEMLLKEKRPKFAPFLEERDSDTEVRMEGSPISSSSSQLSPIPPFTGGSQGGLQNS
RPSSTGLEDISPTPLPDSEDEEPILGTSSLLKRISSPVQDKVGNSDRGTTPTDKTDPGPQ
SSGEDMEISDDEMPGTPIADGDCAKGIVVNSAVSPMQTLSLPPPGFPSLSHQPGFPIPHH
HLTPHTAVPGHPAHLASHPGVSHHMLAHMDPYVHSMMPLMQMELMNCLRWEQWSTVPMSF
QMQQQMLSRMAQTRGPYPYPHFMDGGASGPFGAPYAPLSMGAAPGSNAGMPGQQWQHPSI
PTFNPNVPPPGYDTKKEDPHKATVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWW
DKKERSAKASLTPVKGTEVKEEERPKPKETMGSSLLENWNKGEGLGYEGMGLGIGLRGAI
RLPSFKVKRKGPPEAASAGDNKRARPSTPVDDELEDEDRDRDAAELPSDSSKMDGDSASS
KRRHSRPLELDSEGEENDTSGKEEELLSDREEEPEETEAPDRLRSGKESGEEEGDDEAEG
DSSSESSSDSSDDEAESSSYSKASSDSSSASSDSSEYEMSSEEEEEEVDAKVLATQDKES
RSKKLQSSSSSSSSSSSSSTSSSSSSSSSSDEEDREIKIEAPSSPVAPVLKEEDQRSKEE
LSSKIKGRPPSPEEELIQERRPPSPKPSPAKEPHVSVEGNIPVVKSEPPEHEANLRPPTP
TGTLPNSTLEKKGKTEPDEAHFAPGRLASSQLDSKSGMHLPLPPHPEIEGRSLLHPPPGP
LADLPQRTRLPTDEDIPRTPGRDLMERTRSLDTGSLKKKTGRPKGKKAPALSTSDDSLEL
LPESTLLHDAQLADLPTQRISAPSLDRSNLDFRDREVEPQTVLPDEDGFLSYEDEAPVLI
KPTRRQRRGWEALLLDSLSSVTSPQRSYFKPRSEFEEMTILYDIWNEGIDEEDMRLLQIT
YEKMLQQDNGNDWLNDTLWVNHPSTNIPGVKRKRRDDGMRDHMTGCARSEGYYKIDKKDK
IKYLQSTRLQSEEPPIDTQGMSIPAQVHASTRAGSERRSEQRRLLSSFACDSDLLKFNQL
KFRKKKIRFCKSHIHDWGLFALEPIAADEMVIEYVGQNIRQVIADMREKRYEEEGIGSSY
MFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYD
YKFPIEDVKIPCLCGAENCRGTLN
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccgggcgagaggaatagattgaacgaagaccatggcagaaagcagagttca
agtttggcgaacggcatggacagtcatcccgtctgcggctcggcggagaagcggagccac
cactggagaagttacaagttgatcatcgacccggcgctgaagaagggatcccacaaactg
tatcgctacgatggacacactttcagcatgcccaaccccgggataccgccggtggagatg
gttcgagacccgaggatcggtcgtctctggactaagtataaagagacggatctgccggtg
cccaagtttaagatcgacgagtgctacatcggccccgtccccccgaaggaggtgacgttc
gcgcggctcaacgacaacatcagggaagggttcctaaccgacatgtgcaagaaattcggc
gacatcgaggaggtggagattttgtataatccgaagaacaaaaagcacctgggagttgcc
aaagttgttttcgagagcgtgaaggccgccaaagtggcggtgcagtcgctgcatgagacg
tctgttatgggaaacatcatccacgtggagctggacccgaaaggtgagaatcgccagagg
tactatcagctcctgatgaatggcagctacaccccgcggaccctacctgttggagaggaa
gccagagaagtttcccctcgcagtctggcagaagccttactggcctgcgagcccatccgc
aggttatcggagtcaaacctgactgccgttgaaagaggactgccgcccagtagctccacc
acgccggtgtctctggaaactgggtactccagcctgaggcaggaaacaccacagtcccag
ggaacccctcataccccacgtcaggcagggacgcccttctcccaggactccaattactcc
agtcgtcagtctacacctgcataccagtctagccgacccgagagctccggaggttacaag
tcacggaggcacgagagcaagttccaggacgcgtacaaccgcaggccggagaggccgcag
taccgcagcaacatgtaccgaagttcgacgtcagaacaagccccctttnagcaacaccag
ctcaccccacctgaacccccaccgtccaccccctctttcacatacacagcacctccccca
gctacgcccaatttcaagtccacgttctcaccctatcaggctcctctgccccctgcattc
cccccgtcagaaccagttttccatcaccctgcccaaagggaggacgattatccccgacca
ccacagccgccccaagcagctgcccccgactacttgcccaccaaggagagaccagaaacc
cctccgaccccagaaccacccccgccagagcctgcgccccatcccaacaccccacctcca
cagacaccagagcactgcccctcacctggctcgcccacacacgatccggagcgcaacagc
ctggattcccgcatcgagatgctcctcaaggagaaaaggcccaaatttgcaccgttcctg
gaggagcgagactcggacacagaggtacggatggagggaagtcccatttcctcctcgtcc
tctcagctgtcccccattccgccctttacgggcggctcacaaggtggcctgcaaaattcc
cgtccctcaagtacgggcttggaggatatcagcccgaccccactgcccgactcggaagac
gaggagccgattcttgggacttcctcactgctcaagaggatcagctcacctgtgcaggac
aaggtgggcaacagtgacagaggcaccactcctacggataaaacggacccgggtccacag
tcgtcaggagaagacatggaaatctccgatgatgaaatgccaggtactcccatcgccgat
ggagactgtgccaaggggattgttgtaaattctgcagtgtccccaatgcagactttgtcc
ctcccccctcctggcttcccatctctctcccatcagcccggcttcccgatcccacaccac
catctgacccctcacaccgccgtcccgggtcaccctgctcacctggccagccaccctggg
gtgtcccatcacatgctggcacacatggacccttacgttcacagcatgatgcctctcatg
cagatggagctgatgaactgcttgcggtgggagcagtggagcaccgtccccatgtccttt
cagatgcagcagcagatgctgagtcgcatggcacagactcgagggccatatccatacccg
catttcatggacggcggtgcttcggggcctttcggggcaccttacgcgcctctgtctatg
ggtgctgcaccaggaagcaatgcaggaatgcctggacaacagtggcagcatccgagtata
ccaacattcaaccctaacgtcccccctcctgggtatgatactaaaaaggaggacccccac
aaggcaacagttgacggcgtgctgctggtcattgtcaaagagctaaaggccatcatgaag
agggacctgaaccgaaaaatggtggaggtggtggcttttagagcctttgatgattggtgg
gataagaaggaacgctcggcaaaggcatctttgacaccagtcaaaggtactgaggttaaa
gaagaagaaagacccaaacccaaagagacgatgggctcaagtctgttggaaaactggaac
aagggcgaaggcctgggatacgagggaatgggcctgggaatcggtttacggggagccatc
cgcttgccctccttcaaggtgaagaggaagggcccacctgaagctgcgtccgcaggtgac
aacaaacgggctcgaccatcaacaccagtggacgacgagctggaggatgaagaccgcgat
cgagacgcagccgagctcccctcagacagctccaaaatggacggcgacagcgcgtcgtca
aagcggcggcattcgcgaccgctagaactggacagcgaaggagaggagaacgacacctcg
gggaaagaagaggagttgttgtctgacagggaggaggaaccagaagaaacagaggccccc
gataggctgcgttctggaaaagaaagtggagaagaggagggtgatgatgaagcagaggga
gactcgtccagtgagagctcctccgattcatctgatgatgaagcggaaagttcatcttac
tccaaggcgagctcggactcctcttcggcaagttcggactcctcggagtacgagatgagc
tcggaggaggaggaggaggaagtagacgctaaggttttggcaacacaggacaaggagtcc
agaagcaaaaagctccagagctcctcgtcctcgtcctcgtcgtcttcgtcgtcctcaacg
tcgtcttcttcatcgtcatcttcatcctctgatgaagaggacagggaaattaagatcgag
gctccatcctctcctgttgcaccagttctaaaagaggaggaccaaaggagtaaggaggaa
ctgagcagcaagatcaagggaagacctcccagtcctgaggaggagctcatccaggaacgg
aggccaccttcacccaaaccgagtccagccaaagagccacatgttagcgtggagggtaat
attcctgtagtcaagtctgagcctccagagcacgaagcgaaccttcggccacccactcca
acaggcaccctgcccaacagcaccctggagaagaaaggtaaaacagagcccgacgaagca
cactttgcccccggtcgattagcctcatcccagctggattccaaatctggaatgcacctc
cctcttcctcctcacccagaaatagaaggccgctcccttcttcatcctccccctggcccc
ctggccgaccttccccaacgtacccggctcccaacagatgaggatatccctcgcactccc
ggcagggacttgatggagcgcacccggagtctggatactggctcattaaagaagaaaact
ggacgacccaaaggcaaaaaggccccggctctctctacatctgacgactctttggaactc
ttgccagagtccactctgcttcatgatgcacaactcgctgatttgcccacgcagaggata
tctgccccgtctctggatcgttcaaacctggacttccgggacagagaggtggagcctcag
acagtcttgcccgacgaggacggcttcttgtcctatgaagatgaggcacctgtgctcatt
aagccaactcggaggcaacggcgaggctgggaggcgctgctactggacagcctctcttcc
gtcacgtcgccgcaacggtcatacttcaagccacggtcggagttcgaggagatgaccatt
ttgtacgacatctggaatgaaggcatagatgaggaggacatgcggctcttgcagatcact
tatgaaaagatgttgcagcaggataacggcaacgactggctcaatgacactctctgggtc
aaccatccttccaccaacatccctggggtgaagagaaaaagaagagatgacggcatgcga
gaccacatgacgggatgtgcgagaagtgagggatattacaagatcgacaagaaggacaag
atcaagtacctccagagcacgaggctacagtctgaagagccaccgatcgacacacagggt
atgagcatccctgcacaggtccatgcctccaccagagctggctccgagcgtcggtcggag
cagcgacgtttgctctcctccttcgcgtgcgacagcgacctgctgaagttcaatcagctg
aagttccgtaagaaaaagatcagattctgcaagtcgcacatccacgactggggtctattc
gctttggagccaatcgctgctgatgaaatggtgattgaatacgtggggcagaacatccga
caggtcatcgcagacatgcgggagaaacgttacgaggaagagggcatcggcagcagctac
atgttccgcgttgaccacgacaccatcatcgacgccacgaagtgtggcaacttcgcccgt
ttcatcaaccacagctgcaaccccaactgttatgcgaaagtcatcacggtggagtcgcag
aagaagatcgtgatctactccaggcagcccatcaacgttaacgaggagatcacgtacgac
tacaagttccccatagaggacgttaagatcccctgtttgtgtggggccgagaactgcagg
ggaacgctgaattaa

DBGET integrated database retrieval system