KEGG   Vibrio cholerae O1 biovar El Tor N16961: VC1977Help
Entry
VC1977            CDS       T00034                                 

Definition
(RefSeq) aminotransferase
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vch  Vibrio cholerae O1 biovar El Tor N16961
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vch00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VC1977
   00290 Valine, leucine and isoleucine biosynthesis
    VC1977
   00220 Arginine biosynthesis
    VC1977
Enzymes [BR:vch01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VC1977
    2.6.1.66  valine---pyruvate transaminase
     VC1977
Amino acid related enzymes [BR:vch01007]
 Aminotransferase (transaminase)
  Class I
   VC1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:2129250..2130464
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQYYQKKGIRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTAAVALSGGKAVHYICDEEADWYPDLDDIRSKITPKTRGIVLINPNNP
TGAVYSRDFLLEIIEIARKHKLMIFADEIYDKVLYDGAVHTSIATLADDVLVVTFNGLSK
AYRVCGFRGGWMFLTGPKQQAQGYIAGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGISCVKPKGAMYLFPKIDTKMYPIKDDQKMVLDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAISRFERFITTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctatgacattcgaggacca
gtgcttaaacatgctaaacgcatggaagaagaagggcataaaatactgaagcttaacatc
ggtaaccctgccccgtttggtttcgacgccccagacgagatcctagtcgatgtgatccgt
aacctacctacttcacaaggttactgtgactcgaaaggcatttattccgctcgtaaagcg
gtggtgcagtactaccagaaaaaaggtatccgcagtctggacgtcgaagatgtgtacatc
ggcaacggtgcatcagagcttatcgtgatggcgatgcaagccctgctcaacaatggcgat
gaaatgctggtacctgcccctgattacccactgtggacagccgcggtagcactttctggc
ggcaaagccgtgcactacatctgtgatgaagaagccgattggtatcctgacctcgacgat
attcgcagcaaaatcaccccgaaaacccgtggcattgtgctgatcaaccccaataaccca
accggtgcggtttacagtcgtgatttcttgctggaaatcatcgagattgctcgcaagcac
aagctgatgattttcgccgatgagatttacgacaaagtgctgtacgacggcgcggtgcat
acctcaatcgccaccttagcggatgatgtattagtcgtcaccttcaacggcttatccaaa
gcttaccgtgtttgtggtttccgtggtggctggatgttcctgactggccccaaacagcaa
gcacaaggctatattgcagggctcgatatgctggcctcgatgcgcttgtgtgccaacgtg
ccaatgcaacatgccattcaaaccgcactcggcggctatcaaagtatcaatgagctgatt
ttgccgggcggccgactgctggaacagcgtgatcgcgcatgggagctgattaaccagatc
ccggggatttcttgcgtgaagccaaaaggcgcgatgtacctgttcccgaaaattgatacc
aaaatgtatccgatcaaagatgaccagaaaatggtgcttgatttcctagtgcaagaaaaa
gtgctgctagtacaaggcagcggctttaactggccaaaaccggatcacttccgcattgtg
actctgcctcatgtggaagatctggaaatcgccatcagtcgctttgaacgctttatcacg
acttacagccaataa

DBGET integrated database retrieval system