Metarhizium acridum: MAC_03119 Help Entry MAC_03119         CDS       T03104                                  Name (RefSeq) SCF complex subunit Skp1   KO K03094   S-phase kinase-associated protein 1 Organism maw  Metarhizium acridum Pathway maw03083   Polycomb repressive complex maw04111   Cell cycle - yeast maw04120   Ubiquitin mediated proteolysis maw04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:maw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MAC_03119    04120 Ubiquitin mediated proteolysis     MAC_03119   09126 Chromosome    03083 Polycomb repressive complex     MAC_03119  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     MAC_03119  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maw04131]     MAC_03119    04121 Ubiquitin system [BR:maw04121]     MAC_03119    03036 Chromosome and associated proteins [BR:maw03036]     MAC_03119 Membrane trafficking [BR:maw04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     MAC_03119 Ubiquitin system [BR:maw04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      MAC_03119    Cul7 complex      MAC_03119 Chromosome and associated proteins [BR:maw03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      MAC_03119   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      MAC_03119 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Trnau1ap Motif Other DBs NCBI-GeneID:  19247430 NCBI-ProteinID:  XP_007809459 UniProt:  E9DZS1 LinkDB All DBs Position Unknown AA seq 171 aa AA seqDB search MSAEDTSGAKVYLASNDNATLQVDRVVAQRSILIKHMMEDIGYDTISQDNPIPIPNVNEA VLRKVIEWCEHHRNDPPQAQDDESDGRRRTTDIEEWDQKFMQVDQEMLFEIILAANYLDI KPLLDVGCKTVANMIKGKSPEEIRKTFNITNDFTPEEEEQIRRENEWAEDR NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgtccgccgaagacacgtcgggtgccaaggtctacttggcctccaatgataacgccact ttgcaagtcgaccgtgtcgttgcccagcgctccattctcatcaagcacatgatggaggac attggctatgacacgatcagccaggataatcctatcccaattcccaacgtgaacgaggcc gtccttcgcaaggttatcgagtggtgcgagcatcaccgcaacgatcctcctcaagctcaa gacgatgaatctgacggccgacgacgtaccaccgacatcgaggagtgggaccagaagttc atgcaggttgaccaggaaatgctgtttgagatcattctggctgccaactaccttgacatc aagccgctgcttgatgtcggctgcaagactgtggccaacatgatcaaggggaagtcaccg gaagagatccgcaagactttcaatattaccaatgactttacccccgaggaggaggagcag attcgaagagagaatgagtgggccgaggaccggtaa

DBGET integrated database retrieval system