KEGG   T30302 (Metagenome): 16246
Entry
16246             CDS       T30302                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 199.134)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.16246-T1-C
LinkDB
Position
C477761:complement(3..299)
AA seq 99 aa
MNFFQYKNNKLYAEDIPVQQLAEQFGTPLYVYSRATLERHWHAFDSAFGNRPHLICFAVK
SCSNIGVLNIMAKLGSGFDIVSQGELERVITAGGDASKV

KEGG   T30302 (Metagenome): 1629
Entry
1629              CDS       T30302                                 

Definition
protein tabA
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
spn:SP_1978 (best score: 145.591)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.1629-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_1697:211..459
AA seq 83 aa
MKTPFINKEDLEKIVVEFPTPFHLYDEKGIREKARAVNKAFSWNKGFKEYFAVKATPTPA
XLDFPGYEIMFSSNNTPDKEYAY

KEGG   T30302 (Metagenome): 17220
Entry
17220             CDS       T30302                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
vpr:Vpar_1032 (best score: 108.997)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17220-T1-C
LinkDB
Position
C479661:complement(482..655)
AA seq 57 aa
DRIVIHDAGAHGHAMGFNYNGKLRSAELLLHEDGSVTQIRRAETLDDYFATLDFSNL

KEGG   T30302 (Metagenome): 17636
Entry
17636             CDS       T30302                                 

Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
spn:SP_1978 (best score: 243.047)
Taxonomy
Firmicutes - Bacilli [GN:spn]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17636-T1-C
LinkDB
Position
C480411:2..427
AA seq 141 aa
MLAPYGLLVTKVTHKKQTYRTYLGVDASAVNLLRPAMYGSYHHITNMDRPEGETEIVDVV
GSLCENNDKFAINRPLPVSQIGDTLVIHDTGAHGFSMGYQYNAKLRSSEILLEEDGNVRM
IRRAERPEDYFATLYGFDFEK

KEGG   T30302 (Metagenome): 17881
Entry
17881             CDS       T30302                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 449.899)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.17881-T1-C
LinkDB
Position
C480839:complement(2..712)
AA seq 237 aa
KVVFSGVAKSRKEIMRALEVGIRCFNVESVSELKYINQIAGEMGKIAPISLRVNPDVDAH
THPYISTGLKENKFGVSVNEAREVYKLASMLPNIKITGMDCHIGSQLTELQPFLDATDRL
IILMEQLKEDGIKLKHIDLGGGLGVTYTDETPPHPSDYANELLEKLKNYPELEIILEPGR
AISANAGILVAKVQYLKNNESRNFAITDTGMNDMIRPALYEAYMNIVEIDRTLVREK

KEGG   T30302 (Metagenome): 21604
Entry
21604             CDS       T30302                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 664.84)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.21604-T1-C
LinkDB
Position
C486623:complement(3..1109)
AA seq 369 aa
MDFFQYKNEQLYVEDLPVKQLAEEFGTPLYIYSRATLERHWHAFDSALGKHPHLICYAVK
ANSNIGILNVMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSRAEIMRALEVGIR
CFNVESVAELHHINQIAGEMEKIAPISLRVNPDVDAHTHPYISTGLKENKFGVSVDEARE
VYKLAATLPHVKITGMDCHIGSQLTELQPFLDATDRLIRLMEQLKEDSITLKHLDLGGGL
GVTYTDETPPHPSDYATALLNKLKNYEDLEIILEPGRAIAANAGILLAKVQYLKSNESRN
FAITDTGMNDMIRPALYEAYMNIIEIDRSLERKKAIYDVVGPVCETSDFLGKQRELAIAE
GDYIAQRSA

KEGG   T30302 (Metagenome): 22274
Entry
22274             CDS       T30302                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
hin:HI0727 (best score: 150.984)
Taxonomy
Gammaproteobacteria - Others [GN:hin]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.22274-T1-C
LinkDB
Position
C487387:complement(1494..1727)
AA seq 77 aa
VVGPVCETSDFLGKQRELSIAEGDYIAQCSAGAYGASMSSNYNSRPRTAEVLVDGDKSYL
IRRRETLQELWALESTI

KEGG   T30302 (Metagenome): 4606
Entry
4606              CDS       T30302                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
gsa:FOC50_06230 (best score: 240.736)
Taxonomy
Firmicutes - Bacilli [GN:gsa]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.4606-T1-C
LinkDB
Position
SRS016196_WUGC_scaffold_4366:3..413
AA seq 137 aa
VQERLGLTISVLNLGGGFGVYYTEEDRPFELAEFLREYIEVVERESDNFGLDLTKVVIEP
GRSLTCNAGSTLYSVGGVKKTFAGREYVFVDGGMADNPRYALYKAKYEAMLANKMNEEAD
TTYTVAGKCCESGDMLV

KEGG   T30302 (Metagenome): 8307
Entry
8307              CDS       T30302                                 

Gene name
lysA
Definition
diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Best hit
apl:APL_1525 (best score: 199.904)
Taxonomy
Gammaproteobacteria - Others [GN:apl]
Pathway
00300  Lysine biosynthesis
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS016196.8307-T1-C
LinkDB
Position
C460112:1..318
AA seq 106 aa
CFNVESIPELHRINDVAGKMGKIAPISLRVNPDVDAKTHPYISTGLKENKFGVSVQQARE
VYRLAKTLPNVKIVGMDCHIGSQLTELQPFLDATDRLIVLMEQLKE

DBGET integrated database retrieval system