KEGG   T30397 (Metagenome): 18980
Entry
18980             CDS       T30397                                 

Definition
hypothetical protein
  KO
K03476  L-ascorbate 6-phosphate lactonase [EC:3.1.1.-]
Best hit
spy:SPy_0182 (best score: 67.781)
Pathway
00053  Ascorbate and aldarate metabolism
01100  Metabolic pathways
01120  Microbial metabolism in diverse environments
Other DBs
HMP: SRS019024.18980-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23006:complement(1..102)
AA seq 34 aa
LNEEIEEEVVPEGNFAMWWLGNCGTWIKTPGGAN

DBGET integrated database retrieval system