KEGG   T30397 (Metagenome): 23030
Entry
23030             CDS       T30397                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
bths:CNY62_03190 (best score: 142.895)
Taxonomy
Firmicutes - Bacilli [GN:bths]
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.23030-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25911:complement(2..337)
AA seq 112 aa
MKLVFVRHGESEWNALNLFTGWSDVELTPKGVEEAHHAGEMLRSXXXXXXXXXXXXXXVL
KRAIHTGHIVLSELNQDYLPETKSWRLNERHYGALQGLNKQETREKYGDEQV

KEGG   T30397 (Metagenome): 15646
Entry
15646             CDS       T30397                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
lla:L0011 (best score: 75.8701)
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.15646-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20605:complement(3..137)
AA seq 45 aa
XXXKVTLERVLPFWEDKIVPDLKAGKNVFVGAHGNSIRALVKHIK

KEGG   T30397 (Metagenome): 19558
Entry
19558             CDS       T30397                                 

Definition
hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
yti:FNA67_21160 deq:XM25_17750 (best score: 36.965)
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.19558-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_23454:281..343
AA seq 21 aa
XXXMTGTLIISRHGESEWNLQ

KEGG   T30397 (Metagenome): 9319
Entry
9319              CDS       T30397                                 

Definition
hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
sox:TM7x_03065 (best score: 62.003)
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.9319-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_15836:complement(200..316)
AA seq 39 aa
NERDYGDLTGKNKWEVKAEIGEEAFNGIRRGXXXXXXXX

KEGG   T30397 (Metagenome): 28163
Entry
28163             CDS       T30397                                 

Definition
phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
amy:ADJ76_06750 (best score: 206.453)
Taxonomy
Actinobacteria [GN:amy]
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.28163-T1-C
LinkDB
Position
C905502:3..299
AA seq 99 aa
RHGESEWNAKNLFTGWVDVPLSDKGRAEATHGGELLKESGVLPDLLFTSMLRRAIMTANL
ALDAADRHWIPVERNWRLNERHYGALQGKNKKEIRDEYG

KEGG   T30397 (Metagenome): 15647
Entry
15647             CDS       T30397                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
lla:L0011 (best score: 66.2402)
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.15647-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20605:complement(195..320)
AA seq 42 aa
EEQVHIWRRSYDVLPPKMDRDNEYSAHGDRRYAMLXXXXXXX

KEGG   T30397 (Metagenome): 29607
Entry
29607             CDS       T30397                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
spy:SPy_1429 (best score: 226.098)
Taxonomy
Firmicutes - Bacilli [GN:spy]
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.29607-T1-C
LinkDB
Position
C910451:1..351
AA seq 117 aa
VFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKRAIKT
TNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVLP

KEGG   T30397 (Metagenome): 30085
Entry
30085             CDS       T30397                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
rmu:RMDY18_17340 (best score: 204.142)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.30085-T1-C
LinkDB
Position
C912059:2..307
AA seq 101 aa
APRTECLKDVLGRMLPYWESDIKPDLAAGKTVLVAAHGNSLRSLVKHLEGISDEDIAGLN
IPTGIPLYYELDENFKPIKAGEYLDPEAAKDAIAAVANQGK

KEGG   T30397 (Metagenome): 24103
Entry
24103             CDS       T30397                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
rmu:RMDY18_17340 (best score: 245.743)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.24103-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_26662:complement(1..393)
AA seq 131 aa
MTYKLVLLRHGQSEWNEKNLFTGWVDVNLTDKGRAEAKRGGELLAERNILPDVVHTSLQR
RAINTANIALDAADRLWIPVKRTWRLNERHYGALQGKNKSEIREEYGDEKFMTWRRSYDV
PPPPLDDNDPY

KEGG   T30397 (Metagenome): 20484
Entry
20484             CDS       T30397                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
fnu:FN0729 (best score: 114.775)
Taxonomy
Fusobacteria [GN:fnu]
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.20484-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_24123:complement(138..353)
AA seq 71 aa
IRHGESAWNLENRFTGWKDVDLSPKGIEEAKAAGKILKEMNLVFDVAYTSYLKRAIKXXX
XXXXXXXXALI

KEGG   T30397 (Metagenome): 14885
Entry
14885             CDS       T30397                                 

Definition
phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Best hit
sox:TM7x_03065 (best score: 72.7886)
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
05230  Central carbon metabolism in cancer
Other DBs
HMP: SRS019024.14885-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_20055:205..336
AA seq 44 aa
XFNEAYTSSLKRTQQTLAALLEGCGVENLPTTHATELNERDYGD

KEGG   T30397 (Metagenome): 14017
Entry
14017             CDS       T30397                                 

Gene name
gpmI
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Best hit
vpr:Vpar_1087 (best score: 350.132)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.14017-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19430:complement(256..789)
AA seq 178 aa
DGRDVAPQCAQGYLKDLEAYMAELNCGKIATVSGRYYAMDRDNRWDRVELAYNAIVNGQG
ETAASACEAVQQSYDKDAADEFVLPTVIDGEGTIKNGDAVIFCNFRPDRGRELTKALVLP
DFDGFKRKPLSIYMATMTKYEDGLPVHIVYEKDTLSETLGEVLSAGGYRQLXXXXXXX

KEGG   T30397 (Metagenome): 14016
Entry
14016             CDS       T30397                                 

Gene name
gpmI
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Best hit
vpr:Vpar_1087 (best score: 86.2705)
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.14016-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19430:complement(2..127)
AA seq 42 aa
XQDETYDMIILNFANPDMVGHTGSFEAAVKAVQAVDTCLGRI

KEGG   T30397 (Metagenome): 13842
Entry
13842             CDS       T30397                                 

Gene name
gpmI
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Best hit
vpr:Vpar_1087 (best score: 137.117)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.13842-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19291:2..214
AA seq 70 aa
GNAELMVNHETGKVHTAHTTNLVPLILMSDSLKTATLEAGKLCDIAPTLLDLAGIKQPKA
MTGHSLVHKA

KEGG   T30397 (Metagenome): 13622
Entry
13622             CDS       T30397                                 

Gene name
gpmI
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Best hit
vpr:Vpar_1087 (best score: 278.485)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00010  Glycolysis / Gluconeogenesis
00260  Glycine, serine and threonine metabolism
00680  Methane metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
Other DBs
HMP: SRS019024.13622-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_19129:complement(1..471)
AA seq 157 aa
XLVILDGFGLGDQTDTTNAVVQAKPLCFNRLWDTYPHTTLEASGLAVGLPEGQMGNSEVG
HLNLGSGRIVYQDLTRITKDVESGEFYNRPVMKELYEVAKKQSLHLIGXXXXXXXXHALL
DGRDVAPQCAQGYLKDLETYMADLNCGKIATVSGRYY

DBGET integrated database retrieval system