T30397 (Metagenome): 5601 Help Entry 5601              CDS       T30397                                  Name hypothetical protein   KO K00886   polyphosphate glucokinase [EC:2.7.1.63] Best hit amy:ADJ76_03590 (best score: 69.707) Pathway 00010   Glycolysis / Gluconeogenesis 00520   Amino sugar and nucleotide sugar metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01120   Microbial metabolism in diverse environments 01200   Carbon metabolism 01250   Biosynthesis of nucleotide sugars Other DBs HMP:  SRS019024.5601-T1-C LinkDB All DBs Position SRS019024_WUGC_scaffold_12774:181..303 AA seq 41 aa AA seqDB search XNPATPEAVATVCREVIDQLDVKIGVPIGVTFPAPVFNGVI

DBGET integrated database retrieval system