KEGG   T30397 (Metagenome): 5601
Entry
5601              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Best hit
amy:ADJ76_03590 (best score: 69.707)
Pathway
00010  Glycolysis / Gluconeogenesis
00520  Amino sugar and nucleotide sugar metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
Other DBs
HMP: SRS019024.5601-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_12774:181..303
AA seq 41 aa
XNPATPEAVATVCREVIDQLDVKIGVPIGVTFPAPVFNGVI

DBGET integrated database retrieval system