T30397 (Metagenome): 7325 Help Entry 7325              CDS       T30397                                  Name hypothetical protein   KO K00640   serine O-acetyltransferase [EC:2.3.1.30] Best hit caml:H6X83_12735 (best score: 58.151) Pathway 00270   Cysteine and methionine metabolism 00543   Exopolysaccharide biosynthesis 00920   Sulfur metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01120   Microbial metabolism in diverse environments 01200   Carbon metabolism 01230   Biosynthesis of amino acids 05111   Biofilm formation - Vibrio cholerae Other DBs HMP:  SRS019024.7325-T1-C LinkDB All DBs Position SRS019024_WUGC_scaffold_14250:184..351 AA seq 56 aa AA seqDB search MNIRQKMKLDLDTIMEKDPAATTRYLVKRTYSGYKALCAYRRAHELYLKGHKTLAF

T30397 (Metagenome): 29966 Help Entry 29966             CDS       T30397                                  Name serine acetyltransferase-like protein   KO K00640   serine O-acetyltransferase [EC:2.3.1.30] Best hit vpr:Vpar_0142 (best score: 145.976) Taxonomy Other Bacillota [GN:vpr]Taxonomy Pathway 00270   Cysteine and methionine metabolism 00543   Exopolysaccharide biosynthesis 00920   Sulfur metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01120   Microbial metabolism in diverse environments 01200   Carbon metabolism 01230   Biosynthesis of amino acids 05111   Biofilm formation - Vibrio cholerae Other DBs HMP:  SRS019024.29966-T1-C LinkDB All DBs Position C911651:complement(152..370) AA seq 72 aa AA seqDB search LIGTGTKILGDITIGARTKIGCNLVIKHDIPKDMVIFETDPENMYVRKPSRNAAAAQAEE KKIPDNYIEYYI

T30397 (Metagenome): 11292 Help Entry 11292             CDS       T30397                                  Name serine O-acetyltransferase   KO K00640   serine O-acetyltransferase [EC:2.3.1.30] Best hit pmz:HMPREF0659_A6749 (best score: 66.2402) Pathway 00270   Cysteine and methionine metabolism 00543   Exopolysaccharide biosynthesis 00920   Sulfur metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01120   Microbial metabolism in diverse environments 01200   Carbon metabolism 01230   Biosynthesis of amino acids 05111   Biofilm formation - Vibrio cholerae Other DBs HMP:  SRS019024.11292-T1-C LinkDB All DBs Position SRS019024_WUGC_scaffold_17361:complement(217..327) AA seq 37 aa AA seqDB search LKDDVVVYANATILGRITIGKGCIIGANVWVXXXXXX

T30397 (Metagenome): 22104 Help Entry 22104             CDS       T30397                                  Symbol cysE Name serine O-acetyltransferase   KO K00640   serine O-acetyltransferase [EC:2.3.1.30] Best hit rmu:RMDY18_07930 (best score: 146.747) Taxonomy Actinomycetota [GN:rmu]Taxonomy Pathway 00270   Cysteine and methionine metabolism 00543   Exopolysaccharide biosynthesis 00920   Sulfur metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01120   Microbial metabolism in diverse environments 01200   Carbon metabolism 01230   Biosynthesis of amino acids 05111   Biofilm formation - Vibrio cholerae Other DBs HMP:  SRS019024.22104-T1-C LinkDB All DBs Position SRS019024_WUGC_scaffold_25264:171..383 AA seq 71 aa AA seqDB search VEIHPGATIGRRFFIDHGMGIVIGETAEVGDDVMLYHGVTLGGRSLEKVKRHPTIGDRVT IGAGAKVLGPV

T30397 (Metagenome): 22103 Help Entry 22103             CDS       T30397                                  Name serine acetyltransferase   KO K00640   serine O-acetyltransferase [EC:2.3.1.30] Best hit rmu:RMDY18_07930 (best score: 107.457) Taxonomy Actinomycetota [GN:rmu]Taxonomy Pathway 00270   Cysteine and methionine metabolism 00543   Exopolysaccharide biosynthesis 00920   Sulfur metabolism 01100   Metabolic pathways 01110   Biosynthesis of secondary metabolites 01120   Microbial metabolism in diverse environments 01200   Carbon metabolism 01230   Biosynthesis of amino acids 05111   Biofilm formation - Vibrio cholerae Other DBs HMP:  SRS019024.22103-T1-C LinkDB All DBs Position SRS019024_WUGC_scaffold_25264:1..165 AA seq 54 aa AA seqDB search RGAVEIALNYSGMHAIWAHRLTHKLWQKEETKSLARTLSQFARFLTGVEIHPXF

DBGET integrated database retrieval system