KEGG   T30397 (Metagenome): 7325
Entry
7325              CDS       T30397                                 

Definition
hypothetical protein
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
ruk:A4V00_12200 (best score: 48.9062)
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS019024.7325-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_14250:184..351
AA seq 56 aa
MNIRQKMKLDLDTIMEKDPAATTRYLVKRTYSGYKALCAYRRAHELYLKGHKTLAF

KEGG   T30397 (Metagenome): 29966
Entry
29966             CDS       T30397                                 

Definition
serine acetyltransferase-like protein
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
vpr:Vpar_0142 (best score: 145.976)
Taxonomy
Firmicutes - Others [GN:vpr]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS019024.29966-T1-C
LinkDB
Position
C911651:complement(152..370)
AA seq 72 aa
LIGTGTKILGDITIGARTKIGCNLVIKHDIPKDMVIFETDPENMYVRKPSRNAAAAQAEE
KKIPDNYIEYYI

KEGG   T30397 (Metagenome): 11292
Entry
11292             CDS       T30397                                 

Definition
serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
bvs:BARVI_07560 (best score: 56.225)
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS019024.11292-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_17361:complement(217..327)
AA seq 37 aa
LKDDVVVYANATILGRITIGKGCIIGANVWVXXXXXX

KEGG   T30397 (Metagenome): 22104
Entry
22104             CDS       T30397                                 

Gene name
cysE
Definition
serine O-acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
rmu:RMDY18_07930 (best score: 146.747)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS019024.22104-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25264:171..383
AA seq 71 aa
VEIHPGATIGRRFFIDHGMGIVIGETAEVGDDVMLYHGVTLGGRSLEKVKRHPTIGDRVT
IGAGAKVLGPV

KEGG   T30397 (Metagenome): 22103
Entry
22103             CDS       T30397                                 

Definition
serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Best hit
rmu:RMDY18_07930 (best score: 107.457)
Taxonomy
Actinobacteria [GN:rmu]
Pathway
00270  Cysteine and methionine metabolism
00920  Sulfur metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
05111  Biofilm formation - Vibrio cholerae
Other DBs
HMP: SRS019024.22103-T1-C
LinkDB
Position
SRS019024_WUGC_scaffold_25264:1..165
AA seq 54 aa
RGAVEIALNYSGMHAIWAHRLTHKLWQKEETKSLARTLSQFARFLTGVEIHPXF

DBGET integrated database retrieval system