KEGG   T30595 (Metagenome): 3340
Entry
3340              CDS       T30595                                 

Definition
DNA polymerase III
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Best hit
lpl:lp_0705 (best score: 129.413)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.3340-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_868:complement(16653..17510)
AA seq 285 aa
MIDLKNIGQKQTDLLRDAYLNKKVAHSYLFVDPMQKKGLNTAYWLACLFNCTGENKPDGT
CNNCQRILDGNHPDVFLVKLEGKQTLSIDQIRPLKEELAKSPVEGKRRFFIIENAEKLTL
AASNALLNLLEEPVAPVVTILITNNENQILPTVKSRTQILNFSDEKIDSKRAQLLEYGLT
DEEIDDLGDTAKLEEESKYLFQELLEQNDLALVRVSQISGLATKPASQKFIFYQLKTLAM
KSLTSGEKLRKSAFLLELLMTADKMRASNVSFHNTLDYLVLSFER

KEGG   T30595 (Metagenome): 3669
Entry
3669              CDS       T30595                                 

Definition
DNA replication ATPase
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Best hit
lpl:lp_0705 (best score: 115.546)
Taxonomy
Firmicutes - Bacilli [GN:lpl]
Pathway
03030  DNA replication
03430  Mismatch repair
03440  Homologous recombination
Other DBs
HMP: SRS047335.3669-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_948:1..705
AA seq 234 aa
VNCTGTKRPDGTCINCERVLSGNHPDVFLVKPEGKQSLSIDQIRPLKEELAKSPVEGNRR
FFFIENAQTLTMPAANALLNLLEEPVAPVTTILLTNNAQQILPTVRSRTQIIEFNDLAQA
NSKSQDLLLYGFSQEDLENLGETAELDKAVKYFYQELLENNDLAVVSAHKLAGMMKNKVQ
EDYVFYLLKKFCLDGIKQQQLLGNQALLGRLLDCDKMKFSNVSFLNRLDYLALS

DBGET integrated database retrieval system