KEGG   T30765 (Metagenome): 1105120216897
Entry
1105120216897     CDS       T30765                                 

Gene name
JCVI_PEP_1105120216897
Definition

  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Best hit
nde:NIDE2807 (best score: 193.741)
Taxonomy
Nitrospirae [GN:nde]
Pathway
00010  Glycolysis / Gluconeogenesis
00230  Purine metabolism
00620  Pyruvate metabolism
01100  Metabolic pathways
01110  Biosynthesis of secondary metabolites
01120  Microbial metabolism in diverse environments
01200  Carbon metabolism
01230  Biosynthesis of amino acids
04922  Glucagon signaling pathway
04930  Type II diabetes mellitus
05165  Human papillomavirus infection
05203  Viral carcinogenesis
05230  Central carbon metabolism in cancer
Other DBs
CAMERA GOS: JCVI_PEP_1105120216897
LinkDB
AA seq 239 aa
IENICKSAWGIMVARGDLGIETSLTDLPNIQRKIMFYCAVHGKRSIVATHLLESMINNPT
PTRAEVTDIANAIYEGADALMLSGETSVGKYPIECVSFLKSLSIKTEKFKTLGYESDLIA
NSDWESIAMTAKNLCESINADGIIAITRTGATANYISNAKPNGVPIFTFTNNLTTLNQLS
LVGSTHSFYIPRLNNHDKTLMYAKKELKKYFRNKKSLKFVMVSGIFSEEHSDAIQIINF

DBGET integrated database retrieval system