KEGG   T30765 (Metagenome): 1105120221613
Entry
1105120221613     CDS       T30765                                 

Gene name
JCVI_PEP_1105120221613
Definition

  KO
K03355  anaphase-promoting complex subunit 8
Best hit
blq:L21SP5_00540 (best score: 198.364)
Taxonomy
Bacteroidetes [GN:blq]
Pathway
04110  Cell cycle
04111  Cell cycle - yeast
04113  Meiosis - yeast
04114  Oocyte meiosis
04120  Ubiquitin mediated proteolysis
04914  Progesterone-mediated oocyte maturation
05166  Human T-cell leukemia virus 1 infection
Other DBs
CAMERA GOS: JCVI_PEP_1105120221613
LinkDB
AA seq 386 aa
VSCRYSSSVVRLQKSADARMELLKKDRFMSGANWEVVKKYLPKPWNLSKDEILDDIPDGK
ISEMRTVLLNKEKKCYWQFFSDGFLGMKAYDQLTSITNELLDEDGKVSLAYQKYIDELWL
STKFIDKILNWSFVQNTSNQKIFTQLNYSYDAVKGFINAQEEMLVLIEEFSEDEDNDEEM
IAALKQLNREVNEKKIQGKTYLRNLKNAFPEVYKSIETKYASRDILNQQRSELKKFVKSG
RIDSEDAGKLISDIEFKMYNELNTPAKFTLPKSSELIKDIPWLADLSDAAILKFDTLVEV
KLFPFNYHFKEELITKNGLGIIARGIAKLTKDGVEEGSEVLENGEILSHFNEKASNTDKV
ISETHYCNLGSASNIEAIKAVDSKLA

DBGET integrated database retrieval system