KEGG   Aspergillus flavus: AFLA_048480Help
Entry
AFLA_048480       CDS       T01090                                 

Definition
(RefSeq) SET and WW domain protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
afv  Aspergillus flavus
Pathway
afv00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AFLA_048480
Enzymes [BR:afv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AFLA_048480
Chromosome and associated proteins [BR:afv03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AFLA_048480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET Med26 WW CENP-X
Motif
Other DBs
NCBI-GeneID: 7911665
NCBI-ProteinID: XP_002382975
UniProt: B8NSI5
LinkDB All DBs
Position
Unknown
AA seq 947 aa AA seqDB search
MSPHDYADRRSESVTDAVTAMNLEPDRATDTPALNGGSTSLKDDTNGVSRSPSAQNMDVA
VKSRSSSQTPVKKEEETSNTADMEEKVGGDITVKQEPGQPPKLTRSSSQKVVARPPQLFS
HLRDSTAEARVSFELMDSCTYANKYMGYTEHAMECDCAEEWEPALSKNLACGEDSDCINR
ATKIECVGDCGCGPDCQNQRFQRKEYAQVAVIKTEKKGFGLRAEADLRPHQFIYEYVGEV
INEGQFRRRMRQYDEEGIKHFYFMSLSKGEFVDATKRGNLGRFCNHSCNPNCYVDKWVVG
EKLRMGIFAERDIQAGEELVFNYNVDRYGADPQPCYCGEPNCTGFIGGRTQTERATKLSN
ATIEALGIEDADGWDTAVAKRPRKKKMGEDDEEYVDSVQPKSLEENGVTKVMAALMQCQE
KWIAVKLLGRIQRCDDERVRNRVVKMHGYQILNSQLTMWKDDFNVVLQILDILDKFPRLT
RNKIIDSKIEVTIQPLTSCGDERVEKRAATLLQVWSTLEVGYRIPRMKRDPNATAQAVNQ
FERRETIRDQRRRSKSRSRSRSRSIEAPRGPAAQTRGVYGQRNPHHHGPRSFRRQFNPLP
TGWFAAESNGRTYYYSARGDTTWTRPTKPAPQPPPPPKESRDKALQDIIDGIMNAKENTP
KEKSGTPGTPQVSKPIPVKKEGQEKWRGYSEDKQKKVYENTLFPHIKYVVDKFKHKLPKE
DLKRYAKDVAKKLVNSDFKNNRVEDPTKISEKQQKKVKKYCKEFFDKAVLKHRAYEQRKY
EKQAKGMDSKVETPQAPSDDEALDVKMSDDEEDKADEKDTPMTAEETQGGTKRKREGGIA
EDSNLGEYISSSKRQRSSTPPPLPPISPGDDPQNMDNAKKILRDDIDSRSENNEFTPPPP
PPPPPDDEMPSESPETDHAIDQSPSRAEYITDMNKLKSSQPEIEGKV
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctcatgactacgcggaccgtcggtcagaatccgtaacagatgcggtaaccgcg
atgaacctggagcccgacagagccacagatactcccgctcttaacggcggaagcacctca
ttgaaggatgataccaatggcgtgtcccgctcgccctccgctcagaatatggacgttgca
gtaaaatcacgctcctcttcccaaactcctgtcaaaaaagaagaagagacaagtaatact
gcagatatggaggagaaagtcgggggcgacatcactgtcaaacaagaacctggacagccg
cctaaactgactcgcagctcctcccagaaggttgttgcgcggccaccacaactattctcg
cacctccgagatagtacggcggaggctcgggtgtcctttgagctgatggacagttgcact
tatgcaaacaagtacatgggatatactgagcatgcgatggaatgtgattgtgctgaagaa
tgggaacctgccctctcaaaaaatctggcatgtggagaagattccgactgtatcaaccgg
gcgaccaagattgaatgtgtgggcgattgtggatgcggaccggattgtcaaaatcagaga
ttccaacgaaaggagtatgcccaggtagccgtgatcaaaacggaaaagaaagggttcggt
ctgcgtgccgaggccgatttgcgaccgcaccagtttatctacgagtatgtaggcgaagtt
atcaacgaaggccagttccggcgccgcatgaggcagtatgacgaggaggggatcaagcat
ttctattttatgtccctcagcaaaggtgaatttgttgatgcgacaaagaggggtaatcta
ggccggttctgtaaccactcgtgcaatccaaactgctatgtcgacaaatgggtagttggg
gagaagctccgcatgggcatatttgctgaacgagacattcaggccggggaggaattagtt
tttaattacaatgtcgaccgttacggagctgatcctcaaccttgctattgcggcgaaccg
aattgtacaggcttcattggtgggagaacccaaacagaacgtgccacgaagttgtcgaat
gccaccattgaagccctggggatcgaggatgcagatggctgggatacggcggtggcgaag
cggccacgcaagaagaagatgggcgaggatgacgaagagtatgtggatagtgtccagccg
aagtctttggaggaaaatggcgtcaccaaggttatggcggctttgatgcagtgtcaggag
aagtggatcgcggtgaagcttttggggcgaatccaacgctgtgatgacgagcgtgttcgc
aatcgtgtggtgaaaatgcatgggtaccagatcctcaattcgcagctcaccatgtggaag
gacgatttcaatgttgtgctgcagattttggatatcctggataagtttccgcgcctcaca
cgaaataagattattgattcgaaaatagaggttactatccagccgctgacgagctgtggt
gacgagcgtgtcgagaagagggcggctacacttctgcaagtctggtcgaccctggaggta
ggttatcggattccacgcatgaaacgagacccgaatgctaccgcacaagctgtcaatcaa
tttgaacgccgggagactattcgggatcaacgacggcggtcaaagtcccgcagtcggtca
aggtcgcggtcaattgaggccccccgggggcctgcagctcaaactcgaggggtgtacgga
caaagaaaccctcatcatcacggcccaaggtcctttcgtcgtcagttcaacccacttcca
acaggatggttcgccgctgaatcgaatggccggacatactattactcggcgcgtggggat
accacatggaccagaccaactaagccagcgcctcagcctcctccacctccaaaagagtcg
agagacaaagcactgcaggacattatcgatggcatcatgaatgccaaggagaacacgcct
aaggagaaaagcggtacgcctggcacgccgcaagtatctaaaccaattcccgttaagaag
gagggacaggagaaatggagaggttacagtgaagataaacaaaaaaaggtttatgagaat
acgttgttcccgcacataaagtatgtagtggataaattcaagcataagcttccaaaggag
gacttgaaacgttacgccaaggatgtggcgaaaaaactggtcaactctgacttcaagaat
aaccgagttgaggaccctacgaagatcagtgaaaagcagcagaagaaagtcaaaaagtac
tgcaaggaatttttcgacaaagccgtcctaaagcatcgagcttacgaacaacggaaatac
gaaaagcaagcgaagggaatggactcgaaggtcgaaacgcctcaggctccaagtgacgat
gaggcgctagatgtgaagatgtccgatgatgaggaagacaaagctgatgagaaagacact
cccatgactgcagaagaaacccagggaggtacaaaacgaaagagagagggaggcattgca
gaggattccaacttgggcgagtacatttcatcctcgaagagacaaagatcctcaacgccg
ccgccactgcctccaatcagtcctggagacgacccgcaaaacatggataatgcaaagaaa
atcctaagagatgatattgatagtaggagtgaaaacaacgagttcactccaccacctccc
cctccccctccaccagacgatgaaatgcctagtgaatccccagaaacggaccacgccata
gatcaatcaccatctagagctgagtatattacggatatgaacaagctcaaatcatctcaa
cctgagatcgaagggaaggtatga

DBGET integrated database retrieval system