KEGG   Addendum: CAA63158
Entry
CAA63158          CDS       T10000                                 

Gene name
napH
Definition
(KEGG) N-acetylpuromycin N-acetylhydrolase
  KO
K12636  N-acetylpuromycin N-acetylhydrolase
Taxonomy
TAX:132473
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces alboniger)
Module
132473_M00889  Puromycin biosynthesis, ATP => puromycin
SSDB
Motif
Pfam: Peptidase_M28 PA Peptidase_M20
Other DBs
NCBI-ProteinID: CAA63158
GB: X92429
UniProt: Q53737
LinkDB
AA seq 485 aa
MLHRIQRKRAMTAGAVGVLFLAQLVISSSSAAAGESEVTPPPLSQDRIEKHLTRFERIAD
AHGGDRASGTQGYAESVDYTEKLLKKAGYSTQRQQFPFRYTRTLEEKLVLRDGSTPGVVV
SGYSQSTPRGGLTARPTAVGGDTERRQGCRAGAYDGVPAGGRIALVDAGGCSMDDKQRVA
ADAGAAAVIVANTGPGELHTWLADPEAARIPIGGVTQETGRLLAAEARAGRTVQLTLRSL
TERRTTENLIAVSPRGNPEHTVVSGAHLDSVPEGPGINDNGVAAAVLLESALAAAKDHGT
RAEDNRLVFGFWGAEEFGLLGSQHYVDSLTQEERERTGLYLNLEMIGSPNYGLFTLDSKA
TDPVTGQRPAPGSDEIERELTDAFAAQGRTSLPGPADGRSDYVAFLGAGIPTGGLYGGSF
EAKTPEQAALWGGTAGRPYDPCYHLTCDRTAQYSREAATLHGQAFQTVLTHYSRHRLGEA
AAHHG
Reference
PMID:8576156
  Authors
Tercero JA, Espinosa JC, Lacalle RA, Jimenez A.
  Title
The biosynthetic pathway of the aminonucleoside antibiotic puromycin, as deduced from the molecular analysis of the pur cluster of Streptomyces alboniger.
  Journal
J Biol Chem 271:1579-90 (1996)
DOI:10.1074/jbc.271.3.1579

DBGET integrated database retrieval system