KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009315
Entry
AgaP_AGAP009315   CDS       T01036                                 

Definition
(RefSeq) AGAP009315-PA
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00230  Purine metabolism
aga01100  Metabolic pathways
aga04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AgaP_AGAP009315
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    AgaP_AGAP009315
Enzymes [BR:aga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     AgaP_AGAP009315
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 4578014
NCBI-ProteinID: XP_001230685
VectorBase: AGAP009315
LinkDB
Position
3R
AA seq 1157 aa
LRGPCEWISEKCSCVAKGARKISTNQHTMDGTMATTVGINQSGTGGVLLPDAVLDKLYQS
YALKQKRVAFACYLIASILFDVWAIAVPQGQSVESIVVTSVFLTINIVLAIVLRFCGRGR
FRGVIWEIAPHLAWLLAIKQLFLQLFLKGSVTPRDSLGWAVLLNFLVYVTLPVLLKYTGI
LLGLGSFATYVNAIIGLAKKENYFWEQQVANILLLIAATLIGLLCYFLAEAKQRRAFLEA
KQGLEVKMLIEEQSAEQERLLLSVLPEHVAVKMRQDLGSTNSEQFKKIYMSRHENVSILY
ADIVGFTAISSTYSAQDLVKILNELFARFDRLAEKYQQLRIKILGDCYYCISGAPVERPD
HAVLCVHMGLSMVKAIKYVQQKTNSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELA
NKMESSGKAGRVHLSEKTLGFLNGEFEVEPAFGEKREEALRIAGLKTYFITKVLKPFCPS
EHKNGSADPKDVVIEPDGPSEILREDDDDTKVGMPPANGANAGDEPSTPGTDDKTDPLED
DTQASEDYKMRLRKELVSRDGHSEISKDTTIFLTFNDKTHETAYNEYREPHSAVPLLAAL
LVQFVAILYALLVLPRTAVHFEIVIPPLVIIFVMVFISVAESLTGILPAFITLNSKRYND
STSLRKSTAIIIVLLLGVSNVSDMGFFFICFWSFRYFLVAIEIKIDTKSPKKSCKLAASH
RTPLSLNITNVSFASTEMEPASVCLFPSYFSNYTVLILIATSIITQLSHLSKILLMIIIT
AIHCYVNIFHLDEAFRNEDFGIMNVFPLRYTLSALLVAVTIALSFLARHIDKVDRVIFMW
KTEVIDQKEKASDMRRRNEALVYNVLPMHVAEHFMGNRKRSHDDLYSQSYAEVGVLFASM
PNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGLNP
SRIVKPDDPVSVRWAHLALLVEFALELKKALQGINEQSFNHFVLKMGVNHGPITAGVIGA
RKPHYDIWGNTVNVASRMESTGKAGAIQVTEETCQILQTFGYTFEQRGLVAVKGKGQLMT
YYLQGKVPRPTGPTASPILQNLTAMETVQEVDESKESPPALAPPPGDGASPAHQLHSVSS
PSTASPNSVRLNQEYVE
NT seq 3471 nt   +upstreamnt  +downstreamnt
cttcgtgggccgtgcgagtggatcagtgaaaagtgtagctgtgtagcaaaaggcgcacgc
aaaatttcaaccaaccaacacacgatggacggcacgatggcgacgacggtcggtatcaat
cagtccggcaccggtggcgtgctgctgcccgatgccgtcctcgacaagctgtaccagagc
tacgcgctgaagcagaagcgggtcgcgttcgcctgctatctgatcgcctcgatcctgttc
gacgtgtgggccatcgcggtacctcaagggcagagcgtcgagagcatagtcgttaccagc
gtgttcctcaccatcaacatcgtcctggcgatcgtgctgcgcttctgcgggcggggccgt
ttccgcggcgtcatatgggaaattgcaccgcacctcgcgtggctgctcgccattaagcag
ctcttcctgcagctctttcttaaaggctcggtaacgcccagagattcgctcggctgggcg
gtgctgcttaattttttagtgtacgtcaccctgccagtgctgctgaagtacaccgggata
ctgcttgggctcgggtcgttcgccacctatgtcaatgccatcatcgggctggccaagaag
gaaaactatttttgggaacagcaagtggccaacatactgctgctgatcgctgccaccctc
atcgggctgctgtgctactttctggccgaggcaaagcaacggcgcgcgttcctggaggcg
aagcagggcctcgaggtgaagatgctgatcgaggagcagtcagccgagcaggagcggctg
ctgctttccgtgctgcccgagcacgtcgcggtcaagatgcgacaggatctcggttcgacc
aactcggagcagttcaagaaaatctacatgagtcgccatgaaaacgtcagcattctgtat
gcagatattgtcggtttcacggccatctcgtccacctattcggcccaggatctggtgaag
atactcaacgagctgttcgcccgcttcgaccgtctggctgagaaatatcagcagctgcga
ataaaaattctcggcgactgttactactgcatcagcggggcgccggtcgagcggccggat
catgccgtcctctgcgtgcacatgggcctgtcgatggtgaaagcgatcaagtacgttcag
cagaagacaaactcaccggtggatatgcgcgtcggaatacacaccggggcggtgctggcc
ggcatcctcggccagcgccagtggcagttcgacgtctactcgaaggatgtcgagctggcg
aacaagatggaatcgagcggcaaagcaggccgtgtccatctgtcggagaaaacgctcggc
ttcctgaacggggagttcgaagtggagccggccttcggcgaaaagcgcgaggaagcgctc
cgaatagcgggcctcaagacgtacttcatcacgaaagtgctgaaaccgttctgcccgtcg
gagcacaaaaatggttcagccgatccgaaggacgtggtcatcgaaccggacggaccgtcc
gagatcttgcgcgaagacgacgatgacacaaaggtagggatgcccccggcgaacggtgca
aacgcgggagacgaaccatccacgcctggcacggacgacaaaaccgatccactggaggac
gacacgcaggcatccgaggactacaagatgcgcctccgcaaagagctcgtcagccgggac
gggcacagcgaaatcagcaaggatacgaccatcttcctcacgttcaacgacaagacgcac
gagacggcctacaacgagtaccgggagccgcacagtgcggtaccactgctggccgccctg
ctggtgcagttcgtcgccatcctgtacgctctgctggttctgccaaggacggcggtgcac
ttcgaaattgtgataccgccactagtgatcattttcgtgatggtattcatctccgtcgcc
gaaagcctaaccgggattctgccggcattcatcactctaaacagcaaacgatacaacgat
agtaccagcttacggaagtctacggccatcattatcgtcctgctgctgggcgtttcgaac
gtgagcgacatgggatttttttttatttgtttctggagctttcgttactttctcgttgct
attgaaattaaaattgatacgaaaagccctaaaaaatcgtgtaaactggcagcgtcgcac
cggacaccgctcagcctgaacatcacgaacgtgtcgttcgcctcgaccgagatggaaccg
gcgagcgtctgcctgttcccgtcgtacttcagtaactataccgttttaatactaattgcc
acctcaatcataacgcaattatcgcatctcagcaaaattttattaatgatcatcataacc
gcgatccattgctacgtgaacatcttccacctggacgaagcgttccggaacgaggacttt
ggcattatgaacgtctttccgctacgctacactctgtccgcgctgctggtcgccgtaacg
atagcgctttccttcctggcccgacacatcgataaagtagatcgtgtaatattcatgtgg
aagacggaggtgatcgaccagaaggagaaggcgagcgatatgaggcgccggaacgaggcg
ctcgtctacaacgtcctgccgatgcacgtcgcggaacactttatgggcaaccggaagcgc
tcgcacgacgacctgtactcgcagagctacgccgaggtgggtgtcctgttcgctagcatg
cccaacttttccgacttctactcggaggaaacggtcaacaaccaggggctggagtgtttg
cgctttctcaacgaggtcatatctgacttcgatgcgctgctggagctgccccagtttcag
gacatcatcaaaatcaaaacgatcggctccacgtacatggcggcgagcggtctcaacccg
tcccgcatcgtcaaaccggacgatccggtgtcggtccggtgggcccacctggcactgctg
gtagagtttgcgctcgagctgaagaaagcgctgcagggcatcaacgagcagtcgttcaac
catttcgtgctgaagatgggcgtcaaccatgggccgattacggcgggcgtgattggagcg
cgcaaaccccactacgacatctggggcaacacggtaaatgtggcgtcgcggatggaaagc
acgggcaaggccggcgccatccaggtgacggaggaaacctgccagatactgcaaaccttc
ggctacacgttcgagcagcgcgggctcgtcgcggtcaagggcaagggacagctgatgacg
tactacctgcaggggaaggtaccgcgaccgacgggaccgaccgcgtcgccgattctgcag
aacctgaccgcgatggagacggtccaggaggtggacgaatcgaaggaaagcccgccggca
ctggcaccgccaccaggcgatggagcgtcacccgcccaccagctacactcggtgtcgagc
ccgagcacggccagcccgaacagtgtgcggctgaatcaggagtacgtggag

DBGET integrated database retrieval system