KEGG   Aspergillus nidulans: AN4385.2Help
Entry
AN4385.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
Organism
ani  Aspergillus nidulans
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 2872180
NCBI-ProteinID: XP_661989
UniProt: Q5B4Z3
LinkDB All DBs
Position
III
AA seq 1322 aa AA seqDB search
MVSRSNEGPEAPHPASRTPGAPAKGRLTRLGSSPSKRDDKAKDDRMGKTSAKDVAELKDY
IKLADLPKSELRVIMLEIDLLKNLDHPNIVKYQGFVKSAETLNIILEYCENGSLHSIAKN
FGRFPETLVGVYMSQVLHGLLYLHDQGVIHRDIKGANILTTKEGLVKLADFGVASRTTGL
SESSVVGTPYWMAPEVIELSGATTASDIWSLGCTVIELLEGKPPYYNLQPMPALFRIVND
DHPPLPQGASPAVKDFLMQCFQKDPNLRVSARKLLKHPWIVNARRSDSVVPKKSTEYEEA
VKSVQEWNEALRSPESNALRRGTRNENQNPPSLRLDTRHTPTKVTLPSPVSRIVADKFSS
PSSGEEDNWDDDFATAISPSALQLPHLRPHDNFGGMLSSEKLKAFASLDGTVLKSDESFE
ESDDPFKGSLLAGEHDPLKTIRPPPSQQANSGTSQSQNGPYGAHMRRGPPLNTAITPVYG
GQMLQNSSSPIRQQRPPLFYKENSVEDYSDLISANEDVLDRKISAFQESDEHKDLADTGR
SREVIRYQSSYEQEDTPRIGRQISVKRYRGTVEIQQFAENEHDEDFSDILGVDGVTLDKA
ESDDGSNKSTLMLNTKLSNNSWLGDLDDEDDPFALLEEGLDETDLEANIARDKHARLRSQ
VEGLVGSLKTSQDEEVLGDISEQLLAVFCDFPETKNIIISAHGMLPILEILDLCRRRDIT
LCLLKIVNAIIYDDYEIQENLCFVGGIPIINEFAAKKYPREIRLEAAAFVQQMYQTSTLT
LQMFVSAGGLNVLVEFLEDDYEDERDLVLVGVNGIWSVFELQGSTPKNDFCRILSRSSVL
DPLSLVLSRVLDEEGELAEVVEGRIANIFFIFSQAENHVKEMVSERTVLHSTDDGLGVLK
ELKRMTPAHQITMLKFIKNLSMLSTTLDSLQNSNAIDVLTDLLRSTIKRPHFREVSNQIL
NTIYNMCRLNKSRQEDAALNGIVPLLQKIVKTERPLKEFALPILCDMAHSGKVGRRELWR
NKGLAFYISLLSDPYWQVTALDAIFIWLQEETAKVEEHLLENRYDQPSFTDAIVRCLTLS
KANAFENILEPLQKLLRLSPPIASTLARPDLFSRLGQKLHHSKAAVRLNLLRIISSICDS
SEQQGGLLASYGLLDSIRELEHDPAILVRDMAGKLIQSSERNDSYGLCKLKPNVRRGSTS
ATSPGLLANQSAPVTPQLSRQNQSKGYYDSRETQRRPRSAISGSALALRPGSRDGPTPGI
VGGANGSAGASRNRIARGVSNRLSHIELLPNDDDRIPSSITRRSSVLPRRRRLTQFEAER
GS
NT seq 3969 nt NT seq  +upstreamnt  +downstreamnt
atggtatctcggtccaacgagggcccagaagcgcctcatccggcgtctagaacgcccggc
gcacccgcaaaaggacgcctcacgagactcggttccagtccatcaaaacgagacgacaaa
gcaaaagatgacaggatgggaaagacgtcggcgaaagatgttgcggagctcaaggactat
atcaagctcgctgatctccccaagagtgaattgcgggtcatcatgctggagattgacctc
ctgaagaatttggatcacccgaatatcgtgaagtaccaggggttcgtgaagtcggccgaa
acgttaaacatcattctcgaatattgcgaaaatggttctctacactcaattgccaaaaac
ttcggccgctttccggaaactttagtgggggtatatatgtcccaagttctccatggtctt
ctttaccttcacgatcagggcgtcatacacagagatattaagggtgcaaatattcttaca
acgaaagagggccttgtcaagcttgcagacttcggtgtggccagtcgtaccaccggacta
agcgaatcgagcgttgtcgggactccatactggatggcccctgaagtgattgaattatca
ggtgcaactacagcgtctgatatatggagtctgggatgtactgtcattgagctgcttgaa
ggaaaaccgccgtactataaccttcagccgatgccggctcttttccggattgtcaatgac
gatcaccctcccctccctcaaggcgcctcaccagcagtcaaagatttcttgatgcagtgt
tttcagaaagatcccaaccttcgtgtgtccgctcgcaaacttctgaaacacccatggatc
gtcaacgctcgaagatctgactccgtagtccctaaaaaatcaaccgaatatgaagaggcg
gtgaaaagtgtccaggagtggaatgaggctttgcgttcgccggaatcgaatgccctaaga
agaggaaccagaaatgaaaatcaaaacccaccgtctttacggcttgacacgcggcatacg
ccaactaaagttacacttccaagcccagtctccagaattgtcgcggacaaatttagttct
cctagctccggagaagaggataactgggacgatgattttgctacggccatctcgccaagt
gcactgcagctacctcaccttcggccgcacgacaattttggtggaatgctttcttcggag
aaactgaaggcatttgcctctctagatggtacagtcctaaagtctgatgaaagctttgag
gagtccgatgaccctttcaaaggatctctgctggccggagaacatgacccgctgaagaca
atccggcccccgccgtcgcagcaggcaaactcaggaacatcacagtctcaaaacggaccg
tatggtgcgcatatgaggcggggaccgcccctaaataccgccataaccccagtttatggt
gggcaaatgctccaaaactcgtcatctcctatacggcaacaacgtccgccgttgttctac
aaagagaactccgttgaagattactccgatcttatctcggctaatgaagacgtccttgac
cgcaaaatcagtgcttttcaagagagcgacgagcataaagacttagcagacacgggaagg
tccagggaagtcatccggtatcagagttcatacgagcaagaagatacacctcgaatcgga
agacaaatatcagtcaagcggtaccgtgggacagtcgagatccagcagtttgccgagaac
gagcatgatgaggatttttctgatatcctaggggtggatggagtcacgctagacaaggct
gaaagcgacgacggctcaaataagagcacactgatgctaaatacaaaattatcaaacaat
tcttggctaggagatttggatgatgaagatgatcccttcgcactgcttgaggaagggctc
gatgagactgacctcgaagctaatatcgctcgtgacaaacatgcacgactccgaagtcaa
gttgaagggcttgttggttctttgaagacgtcgcaagacgaagaagtacttggggacata
tcggagcagctcttggccgtcttctgcgatttccctgagacgaagaacataataattagc
gcccatggcatgttaccaatattggagattcttgacctatgccgccgccgcgacattact
ttgtgcctactgaaaattgtcaatgcaatcatctatgatgattacgaaatacaggaaaat
ctctgctttgtcggcggtattcccatcattaacgaattcgcggcgaaaaaatatccccgg
gaaatacggctcgaagcagcagcgtttgttcaacagatgtaccaaacatcaacccttacc
cttcaaatgtttgtcagcgcgggagggttaaatgttcttgttgagtttttggaggacgat
tacgaggatgaacgtgaccttgttctggtaggagtgaatggcatctggagtgtttttgag
ttacagggctcgactcccaaaaacgacttttgcagaattttatcacgcagctccgttttg
gatcctttgtcccttgtgttgagccgagtgttggacgaagaaggcgagttggccgaggtc
gtggaaggccgcattgcaaatatcttcttcatcttctcgcaagctgagaatcatgtcaaa
gaaatggtatcggagcgcacagtcttacatagtactgacgatggcttaggggttttaaaa
gaattgaagcgcatgacacccgcccaccaaataactatgctgaagttcatcaagaatctg
tctatgctatcaacaacacttgactctcttcaaaactcaaacgcgattgacgtcttgacc
gacctcttgcggtccacaatcaagcgtccacatttccgggaggtctccaaccagattctg
aatacaatttataatatgtgtcgtctcaacaagtcacgacaagaagatgccgcgttaaat
gggattgtgcctttactccagaagattgtgaagactgaacgtccactcaaggagtttgcg
ttgcctattctctgcgatatggcacactctgggaaagttggccgtcgggagttgtggcgg
aacaagggactcgcattctatatctcattactttctgacccttactggcaggtgaccgct
ttggatgcaatattcatatggcttcaggaagagaccgctaaggtggaagagcatctattg
gaaaatcgttacgatcagccatcattcacagacgcgatcgtgagatgcttgacattgtcc
aaggcgaatgcgttcgagaacatccttgagccgctgcaaaagcttctgaggctcagtcct
ccaatagcctcgaccctggcgcgcccagacttgttcagccggctcggacagaaactccat
cattccaaggctgcggtccgtctgaatctcctgcgcataatttctagcatttgcgactct
agtgagcaacagggcggactacttgcaagctacgggctcctggactcaattcgcgagtta
gagcatgatcctgcgattcttgttcgggatatggctggaaaattaatccagtccagcgag
agaaatgattcgtacggactctgtaaactcaagcccaatgttaggcggggaagtacatct
gccacttcccctggtctccttgccaaccaatcagcgcctgtcactcctcagttgagtcga
caaaaccagtcgaaaggatactacgatagtcgggaaacgcaacggcggccgcgaagtgca
atcagtggctctgcactggctctccgtcctggaagcagagacgggccaactccgggtatt
gtagggggtgctaacggaagtgctggtgcctcaagaaataggatagctcgcggagtgtcc
aatagattgtcgcacatcgagctgttaccgaatgatgatgatcgaatcccgagttctata
actcgtcgatcgtcggtcctcccacgtcgtcgacgattgacgcagtttgaggcggagcga
ggatcgtaa

DBGET integrated database retrieval system