KEGG   Amphiprion ocellaris (clown anemonefish): 111565146
Entry
111565146         CDS       T06018                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111565146
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111565146
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aoce04052]
    111565146
   00536 Glycosaminoglycan binding proteins [BR:aoce00536]
    111565146
Cytokines and growth factors [BR:aoce04052]
 Growth factors
  Growth factors (RTK binding)
   111565146
Glycosaminoglycan binding proteins [BR:aoce00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111565146
SSDB
Motif
Pfam: FGF Fascin Herpes_LMP2
Other DBs
NCBI-GeneID: 111565146
NCBI-ProteinID: XP_023120922
Ensembl: ENSAOCG00000019230
LinkDB
Position
Unknown
AA seq 153 aa
MADGEICALQEQTAGCGLLLPDYRRLTRLYCMNGGHHLQILPDGTVQGQRDDGDAHIVLK
LKAVNIGVVVIQGTEAGXYLAMNDEGRLYSSPTVTDECYFLEKLEENHYNTYQPQKYQDQ
NWYVGLKKNGKPKLGPRTHIGQKAIFFIPRQLE
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcggatggagagatatgcgcactgcaggagcagactgcgggctgcggcctgctgctg
ccggactaccgccggctgacgcggctctactgcatgaatggcggacaccacctccagatc
ctccccgatgggacggtgcagggccagagggacgacggggacgctcacattgttttgaag
ctcaaagctgtgaacatcggcgtcgtggtcatccagggaacagaagcaggatgatatctg
gccatgaatgatgaagggcgtttgtacagctcacccacagtaacggatgaatgctacttc
ctggagaaactggaggagaatcactacaacacatatcagccacagaaatatcaggaccag
aactggtacgtaggtctgaaaaagaatggaaaacctaaattgggtccaaggacccacatt
ggacagaaggccatcttctttatacccagacagctggaatga

DBGET integrated database retrieval system