KEGG   Burkholderia cenocepacia AU1054: Bcen_5143Help
Entry
Bcen_5143         CDS       T00363                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcn  Burkholderia cenocepacia AU1054
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF80017
UniProt: A0A0H2Y0L2
LinkDB All DBs
Position
2:2430716..2430949
Genome map
AA seq 77 aa AA seqDB search
MTKASHASPFLRHLKIAGYCGLAAVVLALFVAMCAILKESALDRDAARHPADTPELHDAS
DGPSASAESARTPGSPG
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagcaagccacgcttcgcctttccttcgccatctgaagatcgccggttattgc
ggcctcgccgcggtcgtcctcgcgctgttcgtcgcgatgtgcgcgatcctgaaggaaagc
gccctcgaccgcgatgccgcgcggcatccggccgatacgcccgaactgcacgacgcgagc
gacggcccgtccgcctcggccgaatcggcccgcacacccggctcgcccggctga

DBGET integrated database retrieval system