KEGG   Brugia malayi (filaria): Bm1_40580Help
Entry
Bm1_40580         CDS       T01050                                 

Definition
(RefSeq) Glycosyl hydrolases family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00052  Galactose metabolism
bmy00500  Starch and sucrose metabolism
bmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Bm1_40580
   00500 Starch and sucrose metabolism
    Bm1_40580
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Bm1_40580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 6103000
NCBI-ProteinID: XP_001899573
LinkDB All DBs
AA seq 906 aa AA seqDB search
MIEIITFYLITLNGIESVIKQVPSDRRIDCLPKPGANKATCLSHKCIWDDEHYCDTTVPA
CYFPPDTGYMVAQKSNFSLKLQKLKDAALNPYDTDIPEIEVQIANSHSVLNVRIGVEGRY
EPTMPLPRAWSTNEQHFTTEISNESELFILRIRRITTGQLIWDTSIGGLLFADQYIQIAT
FLPTDKIYGFGEHVHQNLKHNFTKYTTWPMFARDQPPDPENPYRNLYGVHPFYLGLEKDN
NAHGVLLLNSNPQEITTGPGPHLIYRAIGGILDMTFFPGPKPEQVIQQYLEYIGRPFLPA
YFALGFQFCRYGYNSLIEMKDTIERIRNASIPIDIAYADIDYMQRYKDFTIGKDNWSDFK
EYADELHKNGMHLVLIFDPAVQNVSFIEWENYNQVQREIQSKYPLTKGTKIMLSVVWPDW
HVAFPDFLDPEPTTVEWWIEEFKLFHQMLPFDGIWIDMNEPAAFGTNEYHPFYFDDPERP
AKIIPLKCPISGAHLSNKTVCMSGMTNRGTQRVYNTKNLYGLAETIATQKAQHAATGKRG
AVISRSTFVSSGHYGGHWLGDNSARWIDLRASIIGIQEFNLFGIPYIGADICGFNGETSE
ELCLRWQQLGAFYPFSRNHNEKGGASQEPSRWPDVSRATREANLFRYYYLPFLYSLLFDV
ALHGGTVVRPIFFEFTSDPETHDLGEQFMWGSAMMIVPVYQEGATSVSGYLPSTIWYSLR
EFDYGILAKPGRSEFRAPKDELIPVFVKGGVVIPRQQPNMTTTVSRNNPFELLITVGSSK
STGMLYWDDGESIVEDFTSYNYFYWLFEFVLSADRATLYITPNHTAIGLVVPTLDVVDVI
GYRYQPNLSEVWLNGIPVKIDLQQSHYDSSKNRLLIVKKNLVKIANGKKQILSWSHQKAF
CDNVQC
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaataatcactttttacttaattaccttaaatggaatcgaaagtgttatcaaa
caagtaccatccgatcgacgaattgattgcttgccgaagccaggagctaacaaagctaca
tgcttatctcataaatgcatttgggatgatgaacattattgtgatacaactgttccagcc
tgctactttccacctgatacaggatacatggttgctcaaaaatctaatttttcgctaaaa
ttgcaaaaattaaaagatgcggcactgaatccttatgatactgatataccagaaattgaa
gtacaaattgcgaattctcattcggtgctaaatgtgcgaattggcgttgaaggaagatac
gaaccaacgatgcctttaccaagagcctggagtacaaacgagcagcattttacaacggaa
atttccaatgaatctgaacttttcatacttcgaattcgtcgtataacaacaggacagcta
atttgggacacatcaatcggtggtttacttttcgctgaccaatatattcaaattgcaact
tttttgccgactgataaaatttatggatttggtgaacatgttcatcaaaacttgaagcac
aatttcacaaaatatacaacatggccaatgtttgcaagagatcagccacctgatccggaa
aatccatatcgcaatttatacggggtacatccgttttatcttggcttggaaaaggacaac
aatgcacatggtgtacttcttttgaatagtaatccacaggaaataacaacaggacccggt
ccacatctgatatatcgagctattggtggaatacttgatatgacatttttcccaggacca
aagccggagcaagttatacaacaatatcttgaatatattggccgaccatttcttccagct
tatttcgcacttggattccagttttgtcgatacggttacaatagtttaattgaaatgaag
gatacaattgaaagaattcgaaatgccagcataccaattgatattgcatatgcggacatt
gattatatgcaacgatacaaagattttaccatcggaaaagataactggtcagattttaaa
gagtacgctgatgaactacataaaaacggaatgcatttggtgctcattttcgatcctgca
gtgcaaaatgtaagttttatagaatgggagaattataatcaagtacaacgtgaaattcag
agcaaatatccactaacaaaagggacaaagataatgctttcggttgtgtggccagactgg
catgttgcttttcctgattttctggatccagaaccgacgacagtagaatggtggattgag
gaattcaagctttttcatcaaatgcttccgtttgatggtatttggatcgatatgaatgag
cctgctgcttttggtactaacgaatatcatccattttattttgatgatccagaaagacca
gcaaagataataccgcttaagtgtcctatcagcggtgcgcatttatcaaataaaactgtg
tgtatgtctgggatgacaaatagagggactcagagagtttacaatacgaaaaatttgtat
ggattagcagaaacaatagcaactcaaaaggcgcagcatgcagcaacaggaaagagagga
gcagttatatccagatccacatttgtttcatcggggcattatggtggccattggctcggt
gacaatagtgctcgctggatagacttgagagcttccattattggtatccaagaatttaat
ttatttggtataccatacattggcgcagatatttgtggtttcaatggagaaacaagcgag
gaattatgtttgagatggcaacaactaggtgcattttatcccttttcaagaaatcacaat
gaaaaaggtggagcaagtcaagaaccatctcgatggccagatgtttcaagagccactaga
gaagctaatcttttccgatattattatctcccatttctttacagcttactgtttgatgtg
gcattgcatggtggcaccgttgttcgaccaattttttttgaatttacctctgatcctgaa
acccatgatctcggagaacaatttatgtggggaagtgcaatgatgatcgtccctgtatat
caagaaggtgctacatctgtatctggttatttgccgtcgacaatatggtactctcttcga
gaatttgactatggcatactagcaaaaccaggccgcagtgaattcagagcaccgaaagat
gagctcattcctgtttttgttaaaggaggtgtcgtgataccgcgacaacaaccaaatatg
acaaccaccgtttcaagaaacaatccttttgaattgcttatcacagttggttcgagtaag
tcaactggtatgctatattgggatgatggtgaaagtattgtggaagattttacatcatac
aattatttctactggttattcgaatttgtactcagtgctgacagggctactttatatatc
actccaaaccatactgctataggattggtagtacccacgttagatgttgtggatgttatc
ggttaccgttatcaaccaaatttgagtgaggtatggctcaacggtattccagtcaaaatc
gaccttcaacagtcgcattacgacagttcaaaaaatcgtttactgattgtgaagaagaat
ttggtgaaaatcgctaatggaaaaaagcagatattatcctggtctcatcaaaaagcattt
tgtgacaatgttcagtgctga

DBGET integrated database retrieval system