KEGG   Caenorhabditis briggsae: CBG17963
Entry
CBG17963          CDS       T01054                                 

Gene name
Cbr-ced-4
Definition
(RefSeq) C. briggsae CBR-CED-4 protein
  KO
K20105  cell death protein 4
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr04215  Apoptosis - multiple species
cbr04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CBG17963 (Cbr-ced-4)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CBG17963 (Cbr-ced-4)
SSDB
Motif
Pfam: NB-ARC CARD AAA_16 AAA_22 ATPase_2 AAA_33 DUF2075
Other DBs
NCBI-GeneID: 8584021
NCBI-ProteinID: XP_002642027
WormBase: CBG17963
LinkDB
Position
III
AA seq 554 aa
MLIQDFEPRDALTYLEGEKIFTEDHSDLISNMPTRLERIANFLRAYRRQASELAPLIDFF
EYNNQNHLKDFLDEYLWFATHQPDKLRPVVLVPKFSRQMLDRKLLLGNVPKQMNCFSREF
HVDRVIEKLDEMCDLESFFLFLHGRSGSGKSVIASQALSKSDQLIGINYDSVVWLKDSGT
TPKATFDLFTDLLLMLKRARVVSDTDDSHNMPDFINRVLSRSEDDLLNFPSVEHVTSVVL
KRMIANALIDRPNTLFVLDDVVQEDTIRWAQELRLRCLITTRDVEISNAASPECEFIEVT
PLESYECFELLESYGMPVPAIERDEDILHKTIDLTSGNPAALMMIFKSCEPKTFEKMAQL
NSKLETRGLSAIECITPYCYKSLSSSLQRCVEVLSDEDRSALAFAVIMPPGIDIPVKIWS
CVIPVDICSNEEDQLDDEVADRLKRLSKRGALLSGKRSPVLTYKIDHVIHLFLKHVVDVQ
TIANGISILEQRLHELGNNNTPTPERHMPSKFRRTSAGDMFPKVEDSVIRPEDYSKFMQI
HRTFYDSLKKFTSQ
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgctcatccaggacttcgaaccacgagatgcgctaacctatttggaaggcgaaaaaatt
ttcacagaagaccattctgatctcatcagtaatatgccaactcgtcttgaaagaattgcg
aatttccttcgagcttatcgacggcaagcgtcggaattggctccgctcattgactttttc
gaatacaataatcaaaatcatctgaaggactttcttgatgagtatctctggtttgctaca
catcaacccgataaactacgacctgttgtgctagttccaaaattttcaaggcaaatgctt
gatcgtaaacttctactgggtaacgttccgaaacaaatgaactgcttcagtagagaattc
cacgtggatcgagtgatcgagaagttagacgaaatgtgtgatttggagtcttttttcctg
tttcttcacggacgctctggatcaggaaaatccgtcatcgcgtcacaagcactgtcgaaa
tcagatcaactcattggaataaactacgattctgtcgtgtggctcaaagatagcggaaca
acgccgaaagccacattcgatttattcacagatctactgctgatgctcaaacgagcccgt
gttgtgagcgacacggatgactcgcacaacatgcccgacttcattaaccgtgttctttca
agaagtgaagacgacctgctcaattttccgtccgtcgaacacgttacatctgttgtgctg
aagagaatgattgcgaacgctctcattgaccggccaaatactttgttcgttcttgatgat
gtggttcaagaagacacaatccgttgggctcaggaacttcgccttcgctgtttgatcacc
accagagatgttgaaatttcaaatgcagcttcaccggaatgcgaatttatagaagtcaca
ccgttggaaagttatgaatgcttcgaattgttggaatcatatggcatgccggtgcctgct
attgagagagacgaggatatcttacacaaaaccattgatctaacgagcggaaatccagca
gctctcatgatgattttcaagtcatgcgaaccgaaaacattcgagaagatggcccagctg
aacagtaaactggaaactcgtggattatctgcaattgaatgtatcactccctactgttat
aagtcactatctagttctctccaacgatgtgtcgaagttctttcggatgaagatcgcagc
gctttggcttttgctgttatcatgcctccaggaatagacattcctgtcaaaatatggtct
tgcgtcattccagtggatatatgttccaacgaagaagatcagttagatgacgaagtggcg
gatcggttgaagagattaagcaaaagaggagctctgctcagtggaaaacggtcccccgtt
ttgacctataaaatagatcatgtcattcatctattcctgaagcacgtggttgatgttcag
acgattgcaaatggaatctcgattcttgaacaacgtcttcatgagcttggaaataacaac
acgcctacaccagaaagacatatgccatcaaaattccgtcgtacatctgctggtgacatg
tttccaaaagtggaagattctgttatacgcccagaagattattcaaaattcatgcaaatc
catcgcactttctatgattccctaaagaagttcacatcccaatag

DBGET integrated database retrieval system