KEGG   Candida glabrata: CAGL0H04345gHelp
Entry
CAGL0H04345g      CDS       T01024                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20300  trafficking protein particle complex subunit 1
Organism
cgr  Candida glabrata
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cgr04131]
    CAGL0H04345g
Membrane trafficking [BR:cgr04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    CAGL0H04345g
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    CAGL0H04345g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sybindin Sedlin_N
Motif
Other DBs
NCBI-GeneID: 2888631
NCBI-ProteinID: XP_446984
UniProt: Q6FS10
LinkDB All DBs
Position
H:409583..410062
Genome map
AA seq 159 aa AA seqDB search
MGIHSFWIFDRHCNCIYDREWTLLSNSGSGTINSKQNDETAKLLYGMVYSLRTITQKLSH
GSMKNEIRTIATGKYLVHIFCTASGLWFILLSDFRQQSYSQVLHYIYGHIYVKYVANNLL
SPIDFAENKNETRGQGFRKITNRNFIKSLEAFLAPMVAK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcattcgttttggatatttgatagacattgcaattgtatatatgatcgtgaa
tggactttactctcgaattcaggcagcggtactattaactccaaacaaaatgatgaaact
gctaaattgctgtatggtatggtttactctcttcgaacaataacacagaaactgtcacat
ggatccatgaagaatgaaatacggacgattgcgactggcaaatatttagtgcacattttt
tgcacagcatctggcttatggtttatattattatccgatttccgtcaacaatcttattcg
caggttttacattacatatatgggcatatatatgttaaatatgtcgctaataatctgctg
tcccccatagactttgcagaaaataaaaatgaaaccagaggacaaggtttcagaaagatt
actaacaggaactttataaaaagcctcgaagcattcttagcacctatggttgctaagtaa

DBGET integrated database retrieval system