KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399312
Entry
100399312         CDS       T03264                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04218  Cellular senescence
cjc04310  Wnt signaling pathway
cjc04340  Hedgehog signaling pathway
cjc04371  Apelin signaling pathway
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04530  Tight junction
cjc04630  JAK-STAT signaling pathway
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04934  Cushing syndrome
cjc05160  Hepatitis C
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05216  Thyroid cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100399312
   04340 Hedgehog signaling pathway
    100399312
   04390 Hippo signaling pathway
    100399312
   04371 Apelin signaling pathway
    100399312
   04630 JAK-STAT signaling pathway
    100399312
   04068 FoxO signaling pathway
    100399312
   04151 PI3K-Akt signaling pathway
    100399312
   04152 AMPK signaling pathway
    100399312
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100399312
   04115 p53 signaling pathway
    100399312
   04218 Cellular senescence
    100399312
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100399312
   04530 Tight junction
    100399312
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100399312
   04921 Oxytocin signaling pathway
    100399312
   04919 Thyroid hormone signaling pathway
    100399312
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100399312
   05206 MicroRNAs in cancer
    100399312
   05205 Proteoglycans in cancer
    100399312
   05203 Viral carcinogenesis
    100399312
  09162 Cancer: specific types
   05210 Colorectal cancer
    100399312
   05212 Pancreatic cancer
    100399312
   05225 Hepatocellular carcinoma
    100399312
   05226 Gastric cancer
    100399312
   05214 Glioma
    100399312
   05216 Thyroid cancer
    100399312
   05221 Acute myeloid leukemia
    100399312
   05220 Chronic myeloid leukemia
    100399312
   05218 Melanoma
    100399312
   05219 Bladder cancer
    100399312
   05215 Prostate cancer
    100399312
   05213 Endometrial cancer
    100399312
   05224 Breast cancer
    100399312
   05222 Small cell lung cancer
    100399312
   05223 Non-small cell lung cancer
    100399312
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100399312
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100399312
   04934 Cushing syndrome
    100399312
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100399312
   05162 Measles
    100399312
   05160 Hepatitis C
    100399312
   05163 Human cytomegalovirus infection
    100399312
   05167 Kaposi sarcoma-associated herpesvirus infection
    100399312
   05169 Epstein-Barr virus infection
    100399312
   05165 Human papillomavirus infection
    100399312
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100399312
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100399312
NCBI-ProteinID: XP_008988804
LinkDB
Position
18
AA seq 295 aa
MEHQLLCCEVEAIRRAYPDANLLNHRVLRAMLKEEETCAPSVSYFKCVQKEVLPSRRKIV
ATWMLEVCEEQXCEEEVFPLAMNYQDRFLSLEPVKKSRLQLLGATCMFLASKMKETIPLT
AEKLCIYTDNSIQPEELLQMEPLLVNMLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIGK
HAQTFVALCATDVKFISYPPSMVAAGTVVAAVQGLNLGSPNHFLSYYRLTCFLSRVIKCD
PDCLRACQEQIEGLLESSLRQAQQNQDPKASEEEEEEEGEVDLACTPTDVQDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaggccatccgccgcgcctaccccgatgcc
aacctcctcaaccaccgggtgctgcgggccatgctgaaggaggaggagacctgcgcaccc
tccgtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccaggcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagnagtgcgaggaggaggtcttcccgctg
gccatgaactaccaggaccgcttcctgtcgctggagccagtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcctcgcctctaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacaccgacaactccatccaacccgaggagctgctgcaaatg
gagccgctcctggtgaacatgctcaagtggaacctggccgccatgaccccgcacgatttc
atcgaacacttcctctccaaaatgccagaggcggaggagaacaaacagatcatcggcaaa
cacgcgcagaccttcgttgccctctgcgccacagatgtgaagttcatttcctatccgccc
tccatggtggcggcgggaaccgtggtggccgcagtgcaaggcctgaacctggggagcccc
aaccacttcctgtcctactaccgcctcacctgcttcctctccagagtgatcaagtgtgac
ccggactgcctcagggcctgccaggagcagatcgaaggcctgctggagtcgagcctgcgc
caggcccagcagaaccaggaccccaaggcctctgaggaggaggaagaggaggagggggaa
gtggacctggcctgcacacccaccgacgtgcaggacgtggacatctga

DBGET integrated database retrieval system