KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_135609Help
Entry
CHLREDRAFT_135609 CDS       T01039                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00010  Glycolysis / Gluconeogenesis
cre00053  Ascorbate and aldarate metabolism
cre00071  Fatty acid degradation
cre00280  Valine, leucine and isoleucine degradation
cre00310  Lysine degradation
cre00330  Arginine and proline metabolism
cre00340  Histidine metabolism
cre00380  Tryptophan metabolism
cre00410  beta-Alanine metabolism
cre00561  Glycerolipid metabolism
cre00620  Pyruvate metabolism
cre01100  Metabolic pathways
cre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_135609
   00053 Ascorbate and aldarate metabolism
    CHLREDRAFT_135609
   00620 Pyruvate metabolism
    CHLREDRAFT_135609
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHLREDRAFT_135609
   00561 Glycerolipid metabolism
    CHLREDRAFT_135609
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHLREDRAFT_135609
   00310 Lysine degradation
    CHLREDRAFT_135609
   00330 Arginine and proline metabolism
    CHLREDRAFT_135609
   00340 Histidine metabolism
    CHLREDRAFT_135609
   00380 Tryptophan metabolism
    CHLREDRAFT_135609
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CHLREDRAFT_135609
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CHLREDRAFT_135609
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CHLREDRAFT_135609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Pro_Al_protease
Motif
Other DBs
NCBI-GeneID: 5716375
NCBI-ProteinID: XP_001690955
JGI: 135609
UniProt: A8IJ19
LinkDB All DBs
Position
Unknown
AA seq 536 aa AA seqDB search
MAMSTLRAALGHAARVAHEGSLVGLLSRGMASAAQPAVDHAHHEKSRSALSYAQKLPNQL
FIDGKWVDALSRKTMPVVDPRTEEVVVEVAEGDAADVDRAVEAARRAFDTGPWPRMTAKE
RGRLLYRLADAMEAHVDELAQLETLDNGKPFFYSRHVDVPFAIDHLRYYAGWADKIHGKT
IPVDGPYLAYTFHEPLGVVGQIIPWNFPILMAAWKLGPALAAGNTVVLKPAEQTPMTALK
VAQLAKEVGLPDGVLNVVTGYGPTAGNRVASHPGVDKTAFTGSTEVGRLVAKAAAEQLKP
CTLELGGKSPIIVCPDVDVDKAVADAHMALFFNHGQCCAAGSRVYVHEAVYDEFVRKSTE
AAATRKVGDPFSSVEQGPQVDDDQFKKILSYIDSGKRQGAKLMTGGGRKGDRGYYVEPTV
FADVKDDMKIAREEIFGPVQSIMKWKSLDDVIARANNSPYGLAAGVFSNNIDTVNTLTRA
LKSGTVWVNCYNLYDNAVPFGGYKESGIGREKGEYALSNYTQVKAVYQPLSNPAWR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgtccaccctccgagctgcgttgggccatgctgcgcgagtcgcccacgagggc
tcgctggtgggcctgctttccaggggcatggcgagtgctgcccagccggctgtcgaccat
gcacaccatgagaagtccaggtctgctctgtcctatgcccagaagctgcccaaccagctg
ttcatcgacggcaagtgggtggacgccctgtcgcgcaagaccatgccggtggtggacccg
cgcacggaggaggtggtggtggaggtggcggagggcgacgccgccgacgtggaccgggca
gtggaggcggcgcggcgcgccttcgacaccgggccctggccccgcatgaccgccaaggag
cgcggccggctgctgtaccggctggctgacgccatggaggcgcacgtggacgagctggcg
cagctggagacactggacaacggcaagcccttcttctacagtcgccatgtggacgtgccc
ttcgccatcgaccacctgcgctactacgcgggttgggctgacaagatccacggcaagacc
atcccggtggacggcccctacctggcctacaccttccacgagccgctgggcgtggtgggg
cagatcatcccctggaacttccccatcctgatggccgcctggaagctgggccccgcgctg
gccgccggcaacacggtggtgctcaagcccgcggagcagacgcccatgaccgcactcaag
gtggcgcagctggccaaggaggtgggcctgcccgacggcgtgctcaacgtggtcacgggc
tacgggcccacagccggcaaccgggtggcctcgcaccccggcgtggacaagaccgccttc
actggcagtacggaggtgggtcgcctggtggccaaggccgcggcggagcagctcaagccg
tgcaccctggagctgggcggcaagagccccatcatcgtgtgccccgacgtggacgtggac
aaggcggtggcggacgcgcacatggcgctgttcttcaaccacggccagtgctgcgccgcc
ggctcacgtgtgtacgtgcacgaggccgtgtacgacgagttcgtgcgcaagagcaccgag
gccgcagccacccgcaaggtgggcgacccgttcagctctgtggagcaggggccgcaggtg
gacgacgaccagttcaagaagatcctgtcctacatcgacagcggcaagcggcagggcgcc
aagctgatgacgggcggcgggcgcaagggcgaccgcggctactacgtggagcccaccgtg
ttcgcggacgtcaaggacgacatgaagattgcgcgtgaggagatcttcgggcctgtgcag
tccatcatgaagtggaagagcctggacgacgtgattgcccgcgccaacaactcgccctac
ggcctggctgccggcgtgttctccaacaatatcgacaccgtcaacaccctgacacgcgcg
ctcaagagcggcactgtgtgggtcaactgctacaacctgtacgacaacgcggtcccgttc
ggcggctacaaggagagcggcattgggcgtgagaagggcgagtacgcgctgtccaactac
acgcaggtcaaggccgtgtaccagcccctgtccaaccccgcctggcgctaa

DBGET integrated database retrieval system