KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_140509
Entry
CHLREDRAFT_140509 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K22464  fatty acid photodecarboxylase [EC:4.1.1.106]
Organism
cre  Chlamydomonas reinhardtii
Brite
KEGG Orthology (KO) [BR:cre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHLREDRAFT_140509
Enzymes [BR:cre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.106  fatty acid photodecarboxylase
     CHLREDRAFT_140509
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C NAD_binding_8 Lycopene_cycl DAO
Other DBs
NCBI-GeneID: 5728543
NCBI-ProteinID: XP_001703004
JGI: 140509
UniProt: A8JHB7
LinkDB
Position
Unknown
AA seq 611 aa
MMLGPKTVTRGATKGAAPRSMAARRVGGARRLSVRAAAGPAGSEKFDYVLVGGGTASCVL
ANKLSADGNKKVLVLEAGPTGDAMEVAVPAGITRLFAHPVMDWGMSSLTQKQLVAREIYL
ARGRMLGGSSGSNATLYHRGSAADYDAWGLEGWSSKDVLDWFVKAECYADGPKPYHGTGG
SMNTEQPRYENVLHDEFFKAAAATGLPANPDFNDWSHPQDGFGEFQVSQKKGQRADTYRT
YLKPAMARGNLKVVIGARATKVNIEKGSSGARTTGVEYAMQQFGDRFTAELAPGGEVLMC
SGAVHTPHLLMLSGVGPAATLKEHGIDVVSDLSGVGQNLQDHPAAVLAARAKPEFEKLSV
TSEVYDDKCNIKLGAVAQYLFQRRGPLATTGCDHGAFVRTSSSLSQPDLQMRFVPGCALD
PDGVKSYIVFGELKKQGRAWPGGITLQLLAIRAKSKGSIGLKAADPFINPAININYFSDP
ADLATLVNAVKMARKIAAQEPLKKYLQEETFPGERASSDKDLEEYIRRTVHSGNALVGTA
AMGASPAAGAVVSSADLKVFGVEGLRVVDASVLPRIPGGQTGAATVMVAERAAALLRGQA
TIAPSRQPVAV
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgatgcttggacccaagactgtgacgcgcggcgccaccaagggcgctgcgccacgctcc
atggcagcccgtcgcgtcggtggtgcacgtcgcctgtcggtgcgtgctgctgcgggccca
gctggctcggagaagttcgactacgtgcttgtcgggggtggcactgcctcgtgcgtgctt
gctaacaagctgtcggctgatggaaacaagaaggttctggttctggaggctggccctacc
ggtgacgccatggaggtggctgtgcccgccggcatcacccgcttgttcgcgcacccagtg
atggactggggcatgtcgtcgctgacacagaagcagctggtggcccgcgagatctacctg
gcccgcggccgcatgctgggcggctcctccggctctaacgccacgctgtaccaccgcggc
agcgccgccgactacgacgcttggggcctggagggctggagcagtaaggacgtgctggac
tggttcgtcaaggcggagtgctacgccgacggccccaagccctaccacggcactgggggc
agcatgaacacggagcagccgcgctacgagaacgtgctgcacgatgagttcttcaaggcc
gccgccgccaccggcctgcccgccaaccccgatttcaacgactggagccacccgcaggac
ggcttcggtgagttccaggtgtctcagaagaagggccagcgcgccgacacctaccgcacc
tacctcaagcccgccatggcgcgcggcaacctcaaggtggtgattggtgcccgggccacc
aaggtcaacattgagaagggctcgtcgggcgcacgcacgaccggcgtggagtacgccatg
cagcagttcggcgaccgcttcaccgccgagctggcccctggcggcgaggtgctgatgtgc
tcgggcgcggtgcacacgccgcacctgctcatgctgtcgggcgtgggccccgccgccacg
ctgaaggagcacggcatcgatgtggtgtcggacctgtcgggtgtggggcagaacctgcag
gaccaccccgcggcggtgctggcggcgcgcgccaagccagagtttgagaagctgtcggtg
accagcgaggtgtatgacgacaagtgcaacatcaagctgggcgccgtggcgcagtacctg
ttccagcgccgcggcccgctggccaccaccggctgcgaccacggagccttcgtgcgcacc
tcctcctcgctctcgcagcccgacctgcagatgcgcttcgtgccgggctgcgccctggac
cccgatggcgtcaagtcctacatcgtgtttggcgagctcaagaagcagggccgcgcatgg
cccggcggcatcacgctgcagctgctggccatccgcgccaagagcaagggcagcatcggc
ctgaaggcggctgacccgttcatcaaccccgccatcaacatcaactacttctccgacccc
gccgacctggccacgctggtcaacgccgtcaagatggcgcgcaagatcgcggcgcaggag
ccgctcaagaagtacctgcaggaggagacgttccccggcgagcgcgcctccagcgacaag
gacctggaggagtacatccgccgcaccgtgcactcgggcaacgcgttggtgggcaccgcg
gccatgggcgcctcgcccgcggccggcgccgtggtgtcctccgccgacctcaaggtcttc
ggcgtggagggcctgcgtgtggtggacgcctcggtgctgccgcgcatccccggcggccag
accggcgccgccactgtcatggtggcggagcgcgcggcggcgctgctgcgcggccaggcc
accatcgcgcccagccgccagcccgtggccgtgtaa

DBGET integrated database retrieval system