KEGG   Drosophila grimshawi: Dgri_GH12016
Entry
Dgri_GH12016      CDS       T01061                                 

Definition
(RefSeq) GH12016 gene product from transcript GH12016-RA
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dgr  Drosophila grimshawi
Pathway
dgr03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    Dgri_GH12016
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dgr01009]
    Dgri_GH12016
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dgr03021]
    Dgri_GH12016
   03019 Messenger RNA biogenesis [BR:dgr03019]
    Dgri_GH12016
   03041 Spliceosome [BR:dgr03041]
    Dgri_GH12016
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dgri_GH12016
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dgri_GH12016
Transcription machinery [BR:dgr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dgri_GH12016
Messenger RNA biogenesis [BR:dgr03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     Dgri_GH12016
Spliceosome [BR:dgr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dgri_GH12016
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 6565163
NCBI-ProteinID: XP_001991535
FlyBase: FBgn0119495
UniProt: B4JKQ7
LinkDB
AA seq 456 aa
MGDFDLNVDSLIQRLLENFKKQKEAEEHAQKLLISQQLAAAGVGAASTSAACSMGGGTPP
TPSSSSGSSGGTSASASASASGTSDPLNELTDQQRRMLLQEYSISPPSETMISADGDQIT
VHHPREEPKKSRLKLRDFFVAEFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLEL
EAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYP
ENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGG
LSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKF
LNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQI
LKPSEKKAKYLYSGMNSSRPTTPQRSAPMLATNKKK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgggcgattttgatttaaatgtggacagtttgatacagcggctgctggaaaatttcaaa
aaacaaaaagaggccgaggagcatgcccagaagctgctcatctctcaacaattggctgcc
gccggtgtcggtgccgcctccacttcagctgcctgttcaatgggcggcggcacgcccccc
actcccagcagcagcagcggcagcagcggtggcacatcagcatcggcatcagcatcggca
tcgggtacgagtgatccgttaaatgagctcaccgatcagcagcgacgcatgctgctgcag
gaatattcaatatcgccgcccagcgagacaatgatatcggcggatggcgatcagataacg
gtgcatcatccgcgcgaggagcccaaaaaatccagattgaaattgcgtgatttcttcgtt
gccgaatttgtgcgcagctgccgcaccggcaaacaggtgcagatgacggaggcggaggtg
cgtggcttgtgtctgaagtcgcgcgagatattcttgcaacagccgatattgctggaattg
gaggcaccgctgatcatatgcggcgacatacacggacagtacacagatctgttgcgactc
ttcgaatatggcggatttccaccggctgccaattatctgtttcttggcgattatgtggat
cggggcaagcaatcgctagaaacgatctgtctgctgttggcctacaagatcaaatatccg
gagaatttctttttgttgcgcggcaatcatgagtgtgccagtattaatagaatttatggc
ttttacgacgaatgcaagcgtcgctataatgtcaaactatggaagaccttcacagactgt
ttcaactgtctgccggtggccgcgatcattgacgagaagatcttctgctgccatggcggg
ctcagtcccgatctgcagggcatggagcagatacgtcgcctaatgcgtcccacagatgtg
ccagacactggcctgctctgcgatctgctctggagtgatcccgacaaggatgtgcaaggc
tggggcgagaacgatcgcggcgtcagtttcacctttggcgttgatgtcgtctccaaattc
ttgaatcgacacgagctggacttgatttgtcgtgcgcatcaggtcgttgaggatggctac
gagttctttgcgcgccgacagctcgtcacactgttctcggcgcccaactattgcggtgaa
ttcgacaacgctggcggcatgatgactgtagacgatacgctcatgtgctcattccagata
ttgaagccatcggagaagaaggccaagtatttgtacagtggcatgaactcatcgcgaccc
acaacaccgcagcgcagcgccccaatgttggcgaccaacaagaagaaataa

DBGET integrated database retrieval system