KEGG   Drosophila grimshawi: Dgri_GH13811Help
Entry
Dgri_GH13811      CDS       T01061                                 

Definition
(RefSeq) GH13811 gene product from transcript GH13811-RA
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00052  Galactose metabolism
dgr00500  Starch and sucrose metabolism
dgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dgri_GH13811
   00500 Starch and sucrose metabolism
    Dgri_GH13811
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dgri_GH13811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C DUF4936 DNA_pol_A_exoN
Motif
Other DBs
NCBI-GeneID: 6566664
NCBI-ProteinID: XP_001993443
FlyBase: FBgn0121287
UniProt: B4JR38
LinkDB All DBs
AA seq 584 aa AA seqDB search
MTLQWNLVAGLLWFLSLGSAHKDHHQQQDNENWWRHEVFYQIYPRSFKDSNGDGIGDLNG
ITSRLEYFVDTGITSIWLSPIFKSPMADFGYDISDYRDIQREYGTLSDFDAMIAKANQLG
IKVILDFVPNHSSDEHPWFIKSAKREAGYEEFYVWKDAKVNNDGIRGPPNNWVSVFSGSA
WEWHEGRQQYYLRQFTKKQPDLNYRNPAVLQAMDEILLYWLQKGVSGFRVDAVNYVYEDE
QLRDEPVSGTTTDDSSVDYLKHIYTRNQPENYALIQHWRQLLDKYAAENSVPARVMMTEA
YADLSQLMEFYEDANGVQGSNFPFNFDFITELNADSLAQDFVFYIQRWLTYMPPGHSANW
VLGNHDNPRVASRFGVKTVDAMNMISMTLPGIGITYYGEELGMQDYRDISFADTVDQPAC
DAGPDNYKWISRDPERTPMQWNDEENAGFSTAAQTWLPVHPNYPELNLNAQQEAIRSHYK
VYQSLLKLRKSRVLQDGTFAAQAFNRGVFSFKRELKGQPTILTIVNVSNRYQRVDVSDFI
DMPNHLTILVVSVFSQYRVGERLKTTEVKLSPYEGLVIQLKPRK
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcaatggaacttagttgcaggcctattatggttcctttcattgggatcggca
cacaaggaccaccatcagcaacaggataatgaaaactggtggcgccatgaggtcttctat
cagatctatcccagatcgttcaaagacagcaatggcgatggcatcggtgatcttaatggc
attacctccaggctggaatactttgtggatacgggcattacgtccatctggctaagtccc
attttcaagtcacccatggcggattttggctatgatatatccgattatagggacatccaa
agggagtatggcacactctcggactttgatgcaatgattgctaaggccaatcagctgggc
atcaaagtcatcttggactttgtgcccaatcacagctccgacgaacacccatggtttata
aagtccgctaaacgagaggccggctatgaagaattctatgtgtggaaggatgctaaagta
aataatgatggaattcgaggaccaccaaacaactgggtctctgtgttctctggctctgca
tgggagtggcacgaaggcagacaacagtactatctgcgtcaattcaccaagaaacagcct
gatctcaactatcgcaatcctgccgtgctgcaggccatggacgagattctactgtactgg
ttgcagaaaggtgtttccggttttcgagtcgatgccgtcaactacgtctatgaggatgag
cagctgcgcgatgagccagtaagtggcaccacaactgatgacagttccgttgattattta
aaacacatatacacaagaaatcagccggaaaactatgcactcatccagcattggcgccag
ctgctcgacaaatatgcggcagagaactcagtacccgcaagggttatgatgacagaggcc
tatgcggatctatctcagctaatggaattctatgaagatgcaaatggtgtacagggctcc
aattttccgttcaactttgacttcattactgagctaaatgcagactctctcgctcaggac
tttgtgttctatattcagagatggctgacttatatgccgcctggacactcggccaactgg
gtgctcggcaatcatgacaatccacgagtggcctccagattcggtgtgaagacagtggat
gcaatgaatatgatatcgatgaccctgccgggcattggcattacctactatggcgaagag
ctgggcatgcaggattatcgggacattagctttgcagatacggtggatcagcccgcctgc
gatgcaggtcccgataactacaagtggatttcccgcgatcccgaacgcactccgatgcag
tggaatgatgaggagaatgctggtttctcgactgctgctcagacctggctgccagtgcat
cctaactatccggagctgaatcttaatgcccagcaggaggccattcgcagccactataag
gtctatcaatcgctgctgaagctgaggaaatcgcgagtccttcaggatggtacatttgcc
gctcaggcttttaatcgtggagtgttttcctttaagcgtgaactgaagggtcaacccacc
atactgaccatcgtaaatgtgagcaatcgctatcagcgagtggatgtcagcgatttcatc
gatatgcccaatcacctaaccattttggttgtcagtgttttctcccagtacagggtgggt
gagcgtctgaagaccaccgaggtcaaattgtcaccctatgaaggtttagttatacagctg
aagccccgcaagtaa

DBGET integrated database retrieval system