KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10014
Entry
Dpse_GA10014      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K09215  odd-skipped
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dpo03000]
    Dpse_GA10014
Transcription factors [BR:dpo03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    Dpse_GA10014
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-met C1_4 Rad50_zn_hook Zn-ribbon_8 GAGA DTHCT zf-C2H2_9
Other DBs
NCBI-GeneID: 4817474
NCBI-ProteinID: XP_001356674
FlyBase: FBgn0070073
UniProt: Q29MF5 A0A6I8UJW8
LinkDB
Position
4
AA seq 754 aa
MPTESSSSDVAGGGGGGGSAIPMLRPSRMDQFMSTVAAAAAAAGGGASDGPNSGGGDSRS
SSASRISAAAAAYETQLAYQQHLAAAGLHPGPPPHHREISAFVPVLPTRQALEAKARAGS
NSNYEIIAMMADKRKELALREAAAAAAMLGRGGPPGGPQGPPPGVLYAPPPPPPYLTGPG
PSPTGAGSFPFPPGAATAGLFPPGLGPGMHAGLDRRLLRAPGRASRPKKQFICKFCNRQF
TKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCTECGKGFCQSR
TLAVHKILHMEESPHKCPVCSRSFNQRSNLKTHLLTHTDHKPYECSSCGKVFRRNCDLRR
HALTHAVGEVNSGDYVDVGEEDEARHLSGDEEDSLLEVDSPRQSPVHNLSESAANGEKDE
AERMRLKRKAPVDQEESEEEFDDYDEEEELQEAAGSFPREELREEDEDFEAEEEVQQEVA
PVARQSSAAPAVIVTAGNGKPERQGVTHCHHEGGETYTMRPHGEKQQEEPLSMPPNGPPP
PPGFVANLRYAPPGGAPPVGVPPVVPPPPHHQPHPHLLPPNGDPYLPILHVRRDLHHKSL
NLSKGAPAPPPTPPTIITQAPETSKPPNQPLHSPHEAMPSFLGSIPMRKRILPPPTIDLM
DHHHHHHHQRSYIENQSIYALNMSRHPPRQLLGKPPSTETSGPATEKGPPPPTTQRQSVQ
SVQTVQAVQSVVAPPPVAPPPAPRRTGFSIEDIM
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgcccacggaaagctcatccagcgacgtcgccggcggcggaggaggaggaggcagcgcc
attcccatgcttcgaccctcacgcatggaccagttcatgtccacagtggccgcagctgcg
gcagcggctggcggtggcgcctctgatgggcccaacagcgggggcggcgactcgaggagc
tcatcggccagcaggatctcggcggcagcagccgcctacgaaacacaattggcctaccag
cagcacctggccgccgccggactgcatcctggtccaccgccacaccatcgcgagatctcc
gcctttgtgcccgtgctgcccacgcgacaggcactggaggccaaggcgcgggccgggagc
aactccaactacgagatcattgccatgatggccgacaagcgaaaggagttggccctaagg
gaggcggccgctgctgcggcgatgctgggacgcggtggtccgccgggcggtccacaaggt
ccgccacccggtgtcctgtacgcaccgccacccccaccgccatatctaaccggaccgggt
ccctcgcccacgggtgcgggaagctttccattcccccccggtgccgccacagcaggtctc
tttccccccggtctcgggccggggatgcacgccggactggatcgtcgtctgttgcgtgca
cccggacgcgcctcgaggcccaagaagcagttcatttgcaagttctgcaaccgtcagttc
accaagtcctacaatctgctgatccacgaacggacgcacaccgacgagcgaccctactcc
tgtgatatttgcggcaaggcgttccggcgacaggatcacttgagggatcacaggtacatc
cactcgaaggagaagccattcaagtgcaccgaatgcggcaagggcttctgccagtcgcgc
actctggcggtgcacaagatcctgcatatggaggagtcgccgcacaagtgtcctgtgtgc
agtaggagtttcaaccagcgctccaatctgaagacccatctgctgacccacacggatcac
aagccgtacgagtgctcctcctgcggcaaggtctttcgccgcaactgcgatctgcggcga
catgccctgacccatgccgtgggcgaagtcaactccggcgactatgtggacgttggggag
gaggacgaggcccgtcatctgagtggggatgaagaggactccctgctggaggtggactcc
ccgaggcagagtcctgtccacaacctaagcgaatccgcagcgaacggggaaaaggacgag
gcggagcgcatgcgtctgaagaggaaggcacctgtcgatcaggaggagagcgaagaggag
ttcgatgactacgacgaggaggaggaactgcaagaggcagcaggcagttttcccagagaa
gaactccgggaagaagacgaggactttgaggccgaggaggaggtgcagcaggaagtggct
ccggtggcacggcagtcatcagccgctcctgctgtcattgttacggctggaaatggaaag
ccggagcgccagggggtcacccactgtcaccacgaaggcggggaaacctacaccatgcga
ccgcatggggaaaaacagcaggaagagccattatccatgccccccaacggaccaccgccg
ccacctggttttgtggctaatctgaggtatgccccgcctggcggtgcaccaccagtgggt
gtaccacctgttgttccaccgccaccgcaccatcaaccgcatccccatctcctgccaccc
aacggagatccctatctgccgatactccatgtgcgtcgggatctgcaccacaagagcctc
aatctgagcaagggcgcaccagccccgccccccacaccgcccactatcataacccaagca
ccggagacgagcaagccaccgaatcagccgctgcactcgccccacgaggcaatgcccagc
tttttgggctcgattcccatgcgcaagaggattctgccgccgccgacgatcgatctgatg
gatcatcatcatcaccaccatcatcagcggtcgtatatcgagaatcagagcatctatgcc
ctgaatatgtcgcggcatccgccacgccagttgttggggaaaccaccgagcacagagacg
agtggtccagccacagaaaagggtccaccaccacctacaacgcagagacagtcggtacag
tcggtacagacggtgcaggcggtacagtcggtggtggcaccacctccagttgcaccgcct
cctgcccctagacgcacgggcttcagcattgaggatatcatgtaa

DBGET integrated database retrieval system