KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11753
Entry
Dpse_GA11753      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00190  Oxidative phosphorylation
dpo01100  Metabolic pathways
dpo04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dpse_GA11753
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dpse_GA11753
SSDB
Motif
Pfam: ATP_synt_H YABBY
Other DBs
NCBI-GeneID: 4812672
NCBI-ProteinID: XP_001353056
FlyBase: FBgn0071802
UniProt: Q29D57 A0A6I8UBX6
LinkDB
Position
XR
AA seq 156 aa
MRVSTECDVSSGSGFPTKVYRYWLIDYRQFIDFFTSSAFISWIKVEIKRIKNRKPVQITL
RALKKSFKSSAMGAAFFPVLFFTALWGAVGIGMPIMTPKGPHQNLIRCILMLTAACCWLF
WLCCYMAQMNPLIGPKLKRDVVAMIGRSWDMKIVDG
NT seq 471 nt   +upstreamnt  +downstreamnt
atgagagtttctactgagtgcgatgtatcgagtggaagtggatttcctacgaaagtgtat
cgatattggctaatcgactatcgacagtttattgattttttcacatcgagcgccttcata
agttggataaaagtggaaataaaacggataaaaaacaggaaacccgtacaaatcacactt
cgagcattaaaaaaatccttcaagtcttcagcaatgggtgcagcattttttcctgtgctg
tttttcacggcgctttggggagctgtgggcattggaatgccaattatgaccccaaagggt
ccgcaccagaatttgatacgctgcatccttatgctgacggccgcctgctgctggctcttc
tggctgtgctgctacatggcccaaatgaatcctctgattggccccaaactaaagcgtgat
gtcgtcgccatgattggcaggtcatgggacatgaaaatcgtcgatggctaa

DBGET integrated database retrieval system