KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27758
Entry
Dpse_GA27758      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K16679  wengen
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04013  MAPK signaling pathway - fly
dpo04214  Apoptosis - fly
dpo04215  Apoptosis - multiple species
dpo04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dpse_GA27758
   04391 Hippo signaling pathway - fly
    Dpse_GA27758
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dpse_GA27758
   04215 Apoptosis - multiple species
    Dpse_GA27758
SSDB
Motif
Pfam: TNFR_c6 Comm PhoR DUF3675
Other DBs
NCBI-GeneID: 6903613
NCBI-ProteinID: XP_002136858
FlyBase: FBgn0249122
UniProt: B5DVE3
LinkDB
Position
Unknown
AA seq 371 aa
MMPPRLPHSSGVAAAAATKRVTTSRSISSHNNHFIHSRSTTNTTFHKRRRRRHDISNATD
ATSDATIAPASARCSITRRAPAIIYLALLLLSTTCSLRTVAASSASSTSSSSAATTSASA
SGSGSASEIASSSPCAPQHWWDPLRDKCTACTVCLGEMIPLRPCQLHTNTICGSIYDLKI
DWVVLAKTEPNWKERRKSSEYEHFEQDAPLQHLTHEQLQQLHEEAAAAWVLDWQTGVLYV
AVLTCLIFFSVAACILIHHMRQWRRMERRLDQDVEELSTKLMAKLAEVQSLDGGTFFIGN
ADALRGLPAAAASHAASAAQSGIFQPQHVLLPEKHQGKHQERRILKTLQPGNVYIEENNG
GMMGIGASSKG
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgatgccgccaagactgccccatagctctggagtagcggcagcagcagcaacgaaacga
gtaaccacgagtagaagtattagcagccacaacaaccactttatccatagcagaagcacc
accaatacaacatttcacaagcgccgacggaggcgacacgacatcagcaacgccacagat
gcaacatcagatgccactatagcacctgcctctgccaggtgcagcatcacgaggagagcg
cctgcaatcatctatttggcgctacttcttctctccaccacctgctccctgaggactgtt
gcggcttcatctgcatcttctacatcatcatcatccgcagctactacatccgcgtccgct
tcaggatctggatcagcatcagaaatcgcctccagctccccctgcgccccacagcactgg
tgggacccgttgcgggacaagtgcaccgcctgcaccgtctgtctgggcgagatgatccct
ctccggccctgtcagctgcacacgaacaccatctgcggctccatctacgacttgaaaatc
gattgggtcgtcctcgccaagacggagcccaattggaaggagcgccgaaagtcctcagag
tacgagcacttcgaacaggatgccccgctgcagcatttgacccacgagcaactgcagcag
ctgcacgaggaggcggccgctgcctgggttctcgactggcagacgggcgtcctctatgtg
gccgtcctcacctgcctcatcttcttctcggtggccgcctgcatcctcatccaccacatg
cgccagtggcgacgcatggagcggcgcttggatcaagacgtggaggagctgtcgacgaag
ttgatggccaagctggcggaggtgcagagcctggacggaggaacctttttcattggcaac
gctgacgccttgcgtggattgcccgctgccgccgcctcgcatgcggcctctgcggcgcag
tcggggatcttccagccgcaacatgtgcttctgcctgagaaacatcagggtaagcatcag
gagcgacggattctgaagaccctgcagcccggtaatgtctacatcgaggagaacaatggg
ggcatgatgggaataggtgccagctccaagggttga

DBGET integrated database retrieval system