KEGG   Drosophila virilis: Dvir_GJ15523Help
Entry
Dvir_GJ15523      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06580  ammonium transporter Rh
Organism
dvi  Drosophila virilis
Brite
Transporters [BR:dvi02000]
 Solute carrier family (SLC)
  SLC42: Rh ammonium transporter
   Dvir_GJ15523
CD molecules [BR:dvi04090]
 Proteins
  Dvir_GJ15523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp
Motif
Other DBs
NCBI-GeneID: 6636559
NCBI-ProteinID: XP_002060063
FlyBase: FBgn0202716
UniProt: B4MG13
LinkDB All DBs
Position
Unknown
AA seq 449 aa AA seqDB search
MHTPAGKVSGYIVLMIVQIVFLVLFWLFVRYEKSAMPSQLVAEDAGSANEHVSKYPQFQD
VQVMIFIGFGFLMTFLRKYGYSATGYTLFMSALVVQWSVLMKGFLHMEGGKISLSLESII
DADIAAAVPLISMGALLGRTTPIQLLCMSIFEVALFAANEYLALNVLSICDCGGSITVHA
FGAYFGLAVALMLRPASDQNEAGKHEGANYASDIFAMIGTTFLWVYWPSFNSVLAAGSGG
ERAILNTFLALAAATVTTFVVSALVSHENKLDMVHVQNSTLAGGVAVGTVCNLLLGAHGA
VLIGIIAGTVSVLGYRYLTPWLTSKLRLHDTCGVHNLHGMPALISAIASAIYASLVTADD
YQSELQDIFPAMVGSNSTASKIMGGLGRNASTQAGYQLFGIALTLLIAIGGGILTGAVLK
YTSFRNLQKDEQHQDEQFWEVPALENKEE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcatacgccggctggtaaggtgtcgggctatattgtcctgatgattgtgcaaatagtt
tttctggtgctattctggcttttcgtgcgttacgaaaagtccgccatgccgtcgcaactc
gtcgctgaagacgctggatcagcaaacgaacacgtttcaaaatatccgcaatttcaggat
gtccaggtcatgatattcattggctttggctttctgatgacctttttgcgcaaatacgga
tatagtgccacgggctatacactgttcatgtccgctctggtggtgcagtggtccgtcctg
atgaagggtttcctgcacatggaaggcggcaagatcagcctttcgctggaaagcatcatc
gatgcggacattgccgccgccgtgccgctgatcagcatgggcgcacttctgggccggacc
acgcccattcagctgctatgcatgtccatctttgaggtggccctgttcgcggccaatgaa
tacctggccctaaatgtactcagcatctgcgactgtggaggctccatcacggtgcacgct
tttggcgcctactttggcctggctgtggccctgatgctgcgccctgcgagtgaccagaac
gaggcgggcaagcacgagggcgcgaactatgcatccgatatattcgctatgatcggcacc
acttttctctgggtatactggcccagttttaactcggtgctggcagccggatccggcggc
gagcgcgccattttgaacacgttcctcgcattagccgcggcaacagtgaccaccttcgtt
gtatccgcacttgtcagccatgagaataaattggatatggtgcacgtgcagaactcgacg
ctcgccggcggcgttgccgttggcaccgtttgcaacttgctgctcggcgcgcacggcgct
gtcttaattggcattatcgccggcacggtttcggtgctcggctatcgctatttaaccccc
tggttgaccagcaaactgcgtttgcatgacacgtgtggcgtacacaatttgcacggcatg
ccggcgctgatatcggccatcgcctcggccatctacgcctcgttggtcaccgcggacgac
tatcaatcggagctacaggacattttcccagccatggtgggcagcaacagcacggcaagc
aaaattatgggcggcctgggacgcaatgccagcacacaggcgggctatcaactgtttggc
attgccctgactctgctaatagccattggaggcggcattttgacaggcgccgtcttaaag
tataccagctttcggaatctgcaaaaggacgagcagcaccaggatgaacagttctgggag
gtgccggccctggagaacaaggaggaatag

DBGET integrated database retrieval system