KEGG   Juglans regia (English walnut): 108998828Help
Entry
108998828         CDS       T05245                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00630  Glyoxylate and dicarboxylate metabolism
jre00710  Carbon fixation in photosynthetic organisms
jre01100  Metabolic pathways
jre01200  Carbon metabolism
Module
jre_M00165  Reductive pentose phosphate cycle (Calvin cycle)
jre_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
jre_M00532  Photorespiration
jre_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:jre00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    108998828
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108998828
Enzymes [BR:jre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     108998828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 108998828
NCBI-ProteinID: XP_018831083
UniProt: A0A2I4FHG8
LinkDB All DBs
Position
Unknown
AA seq 174 aa AA seqDB search
MSAGIFTAPVTGSGFIGLKSNSRKLPVKDSTGWNQKTISNGSRTFCMKTWNPINNKKFET
LSYLPPLSDDSIAKEIDYMIKKGWIPCLEFDQVGSVRRENSQIPGYYDGRYWTLWKLPMF
GCNDSSQVLNEIQECKKTYPNAYIRCLGFDNKQQVQCMAFVIQKPTATSGSTGA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgggatcttcacagctccggtcactgggtcaggatttattggcttgaaatcc
aactcgagaaagctgccggtaaaagattctactggatggaaccagaaaactatctccaac
ggttctagaactttctgcatgaagacatggaatcccattaataacaagaagttcgagaca
ctctcctatctccctcctctctcggatgattcaatcgcaaaggagatagactacatgatc
aaaaagggatggatcccttgccttgagtttgaccaggtggggagtgttcgtagagagaat
agccaaataccaggatactatgatgggaggtattggacattgtggaagctgccaatgttt
ggctgcaatgactcatctcaagtcctcaatgaaatccaagagtgcaaaaagacgtaccca
aatgcctatatacgctgcttgggctttgacaacaagcagcaggtgcagtgcatggccttt
gttattcagaaaccgaccgccaccagcggcagcaccggcgcttaa

DBGET integrated database retrieval system