KEGG   Oryctolagus cuniculus (rabbit): 100349971
Entry
100349971         CDS       T03373                                 

Gene name
NLRP4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100349971 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100349971 (NLRP4)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100349971 (NLRP4)
Pattern recognition receptors [BR:ocu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100349971 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 LRR_6 NOD2_WH AAA_16 VirE
Other DBs
NCBI-GeneID: 100349971
NCBI-ProteinID: XP_017194916
LinkDB
Position
Un
AA seq 925 aa
MASSFFSDFGLIWYLGELRREELAKFKELLRLETSQLGIQQIPWAKVKVASREVLADLLT
KHYGEQQAWDMTLRIFHTMGREDLCERARRERTGADKMYQDHVRSTFPHVWSRDSLFRSH
EFEWKLTQEERETLKFVLAPTDTGRQFHTVVLQGSRGIGKTALLRKLMLAWSDGSIYQDR
FSYVFYLCCREVRQLASTSLASLISRDWPHHSTPLADVVSQPERLLFLVDNVEEMSGDMA
GPPSDLCSHWLEPRPGKVLLRSLLAKSLLPAAFLLLAVTPQCRGELLSGLQDPSVKTVLG
FSRNSKKLYFGSLFSNKRRALEAFQLVNRNDRLFSMCQNPILCWLVGTSMKQDMDRGRDV
ALTCQSVTSTFISFIFNAFTPNGAAYPTQQSQEQLKNLCSLAAEGTWTHIQFFNQEVLGR
NGIGDTAIPTLLDTKVLRCRAPENLYGFPHKALLQFCTALFYLLQHPSAHPNPAVQCTRT
LLLTVLNRNRSSILLGLFLFGLLNERERQKLDAFFGSNLSRQRKEELEQLLQNISGCADF
HPQVDFLVLFYCLSEIQDDVFAGQVMACFQELNLTFLSSSDLGMAASYLKHCYNLRKLCF
SIQALFRGEDPRTYRTRQNFLYWSQICSVLASSEHLQELQVVDSSFTEPTLVIFCHQLRQ
PGCRLQKLMMNKVTMTCEKLAFFEVFTHNPGLKYLRLNRMALSWDDMKLLREALNHPMCG
VEGLLLTSCHLSEAAWELLAQVLISNCRLLYLDVSINILGDAGLKQFCDALRHPSCRLRS
LRVFECLITAAGCGDLAQALVSSQDLRCLQIGSNAIGDAGVKLLCEALVQPSCHLETLGL
QICGLSSACCEDLAYALTGSRTLQDLDLSCNALDHNGLAVLLAAVSHPGCALKVLRLKHM
ELGEETQALLTAVQERNPYLRVISQ
NT seq 2778 nt   +upstreamnt  +downstreamnt
atggcatcctccttcttctcggacttcggccttatatggtacctgggggagctgagaagg
gaggagttggccaagtttaaggagctcctcaggctggagacttcgcaacttggaatccag
caaatcccctgggcgaaggtaaaggtggcgtcccgggaagttctcgcggacctgctgacc
aagcactatggggagcagcaggcgtgggacatgaccttgaggatatttcacacgatgggc
agggaggacctctgtgagagggccagaagagagaggacgggcgccgacaagatgtatcaa
gaccacgtcaggagcacatttccccacgtgtggtccagagactccttgtttagaagtcac
gagttcgagtggaagctgacccaagaggaacgggagactttaaaattcgtcttagctccg
acggacaccggaagacagttccataccgtggtcttacagggatccagagggatcgggaag
acggcactgctgaggaagctgatgctggcctggtcggacggcagcatctaccaagacagg
ttctcgtacgttttctacctctgctgccgagaggtgaggcagctggccagcacgagcctg
gcgtcgctcatctccagagactggcctcaccactccactcccctggcggatgtcgtgtcc
cagcctgagagactcctgttcctcgtcgacaacgtcgaagagatgagcggtgacatggcc
gggcccccgtccgatctgtgcagccactggttggagccgcggccggggaaggtgcttctg
cgcagcctgctggcgaagtccctgctcccggccgccttcctgctcctcgcggtcacgccc
cagtgccgaggggagctgctgagtgggctgcaggatccgagcgttaaaacagtcttggga
ttcagcaggaacagcaagaagctgtatttcggcagcttgttttcaaacaagcgtagagcc
ttggaagccttccagttggtgaacagaaacgaccgcctcttctccatgtgccaaaacccc
atcctttgctggctcgtgggcacgtccatgaagcaggatatggacaggggcagagatgtg
gcgctgacctgccagagcgtcacctctacgttcatctccttcatcttcaacgcgttcaca
cccaacggtgctgcgtatccaacccagcagagccaggagcagctgaagaacctgtgttcc
ctggctgcggagggcacgtggacacacatacagttcttcaaccaggaggtgctcgggaga
aacgggatcggggacacggccatccccacactgctggacaccaaggtgctgcggtgccgg
gcgcccgagaacttgtacggcttcccccataaggctctgctgcagttctgcaccgccctg
ttctacctgctgcagcaccccagcgcacaccctaaccctgcagtccagtgcacacggacg
ctactgctgaccgttctgaacagaaacaggtcttcgatcttgctggggttgttcctgttc
ggcctgttaaacgaaagggagcgacagaagctggatgcgttctttggctcaaacctgtcc
cgacagagaaaagaggaactggagcagttgctgcagaacataagtgggtgtgcagatttt
cacccgcaggtggatttcttggtcttgttttactgtctctcggagattcaggacgacgtc
tttgcagggcaagtgatggcctgcttccaagaactgaacttgaccttcctttccagctcc
gacctggggatggctgcctcctacttaaaacattgttacaacctgaggaagctttgcttt
tccatccaagccctgtttaggggagaagacccgaggacgtacaggacgaggcagaacttc
ttgtactggtctcagatctgctctgtgctcgcctccagtgagcacctccaggaactgcag
gtggtggacagcagcttcacggagcctaccttggtgatcttctgtcatcaactgaggcag
cccgggtgccgcttgcaaaagctcatgatgaataaagtcaccatgacgtgtgagaagctg
gctttcttcgaagtgttcactcacaacccaggcttgaaatacctgagactcaaccgcatg
gctctctcgtgggatgacatgaagttgctgcgtgaggccctgaaccacccgatgtgcggc
gtggaggggctcctgttgaccagttgccacctcagtgaggccgcctgggaactcctggct
caagtcctcatttccaactgcaggctgctgtacctggacgttagcatcaacatcctggga
gacgcggggctgaagcagttctgtgacgccctgagacaccccagctgccgcctgcggtct
ctgcgcgtgttcgaatgtttgatcaccgctgccggctgtggagacctggcccaggctctg
gtcagcagccaggacctcaggtgtctgcagattgggagcaacgctataggggacgccggc
gtgaagctgctgtgtgaggcgctggtgcagcccagctgccacctggagaccctcgggctg
cagatatgtgggttaagcagcgcctgctgtgaggatctggcttacgctctcacgggcagc
aggactctgcaggatttggacctgtcctgcaacgccctggaccacaatgggctggctgtg
ctgctggcagccgtgagccacccagggtgtgccctgaaggtgctgaggctgaaacacatg
gaactcggagaggaaacccaggcgcttctgacggctgtgcaagagcggaatccctacctg
agggtcatcagccaatga

DBGET integrated database retrieval system