KEGG   Pan troglodytes (chimpanzee): 743295
Entry
743295            CDS       T01005                                 

Gene name
LAT
Definition
(RefSeq) linker for activation of T-cells family member 1 isoform X5
  KO
K07362  linker for activation of T cells
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr05135  Yersinia infection
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    743295 (LAT)
   04015 Rap1 signaling pathway
    743295 (LAT)
   04064 NF-kappa B signaling pathway
    743295 (LAT)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    743295 (LAT)
   04660 T cell receptor signaling pathway
    743295 (LAT)
   04658 Th1 and Th2 cell differentiation
    743295 (LAT)
   04659 Th17 cell differentiation
    743295 (LAT)
   04664 Fc epsilon RI signaling pathway
    743295 (LAT)
   04666 Fc gamma R-mediated phagocytosis
    743295 (LAT)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    743295 (LAT)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    743295 (LAT)
SSDB
Motif
Pfam: LAT
Other DBs
NCBI-GeneID: 743295
NCBI-ProteinID: XP_001147360
Ensembl: ENSPTRG00000034140
LinkDB
Position
Unknown
AA seq 410 aa
MGSSGEEVGVQEGDPSPQGQPQGLGAICNRIKFVARPQVPALVFLWVASDLVPRLHPRAP
EDCGSFLGALGESLPFWAGRLRWGTALLRVSWLSVTVSHAPASLEPVPCLTGLAEVGVGT
ALCTPEFPLSGPPCSLPPRVLDMEATAASWQVAVPIWGASRPLGPRGAAGLLRAPLQMEE
AILVPCMLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPA
YPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADED
EDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSTESIDDYVNVPESGESAEA
SLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgggtagctcaggggaggaggtgggggtccaggagggggatccctctccacaggggcag
ccccaagggctcggtgctatttgtaacagaataaaatttgtagccagaccccaggtgcct
gctctcgtctttctctgggtggcctctgatcttgtaccccgtcttcaccccagggctcct
gaagactgtgggtcattcctcggggctctgggtgagtctctgcccttctgggctgggcga
ctgagatgggggactgctcttctccgagtgagctggctgagtgtgaccgtgagtcacgcc
cctgcttccctggagcctgtcccttgcctcacaggcctggctgaggtgggggtgggcact
gccctttgtaccccagaattcccactgtcagggcctccctgctcgctgcctccccgggtc
ctggatatggaggccacggctgccagctggcaggtggctgtccccatctggggggccagc
agacccttggggcctaggggtgcagccggcctgctccgagctcccctgcagatggaggag
gccatcctggtcccctgcatgctggggctcctgctgctgcccatcctggccatgttgatg
gcactgtgtgtgcactgccacagactgccaggctcctacgacagcacatcctcagatagt
ttgtatccaaggggcatccagttcaaacggcctcacacggttgccccctggccacctgcc
tacccgcctgtcacctcctacccacccctgagccagccagacctgctccccatcccaaga
tccccgcagccccttgggggctcccaccggacgccatcttcccggcgggattctgatggt
gccaacagtgtggcgagctacgagaacgaggaaccagcctgtgaggatgcggatgaggat
gaggacgactatcacaacccgggctacctggtggtgcttcctgacagcaccccggccact
agcactgctgccccatcagctcctgcactcagcacccctggcatccgagacagtgccttc
tccacggagtccattgatgattacgtgaacgttccggagagcggggagagcgcagaagcg
tctctggatggcagccgggagtatgtgaatgtgtcccaggaactgcatcctggagcggct
aagactgagcctgccgccctgagttcccaggaggcagaggaagtggaggaagagggggct
ccagattacgagaatctgcaggagctgaactga

DBGET integrated database retrieval system