KEGG   Rattus norvegicus (rat): 497963
Entry
497963            CDS       T01003                                 

Definition
(RefSeq) similar to Nitric oxide synthase, inducible (NOS type II) (Inducible NO synthase) (Inducible NOS) (iNOS)
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04146  Peroxisome
rno04371  Apelin signaling pathway
rno04926  Relaxin signaling pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05133  Pertussis
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    497963
   00330 Arginine and proline metabolism
    497963
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    497963
   04066 HIF-1 signaling pathway
    497963
   04020 Calcium signaling pathway
    497963
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    497963
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    497963
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    497963
  09162 Cancer: specific types
   05222 Small cell lung cancer
    497963
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    497963
   05014 Amyotrophic lateral sclerosis
    497963
   05022 Pathways of neurodegeneration - multiple diseases
    497963
  09171 Infectious disease: bacterial
   05133 Pertussis
    497963
   05152 Tuberculosis
    497963
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    497963
   05145 Toxoplasmosis
    497963
   05140 Leishmaniasis
    497963
   05142 Chagas disease
    497963
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     497963
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 497963
NCBI-ProteinID: XP_006247011
RGD: 1598227
Ensembl: ENSRNOG00000057443
LinkDB
Position
10q25
AA seq 1146 aa
MREGLSSACDAARPRLCRFLRRIFGPKVASRVGPASPTTQDDPKSHKHQNGFPQFLTGTA
QNVPESLDKLHVTPSTRPQHVRIKNWGNGEIFHDTLHHKATSDISCKSKLCMGSIMNSKS
LTRGPRDKPTPVEELLPQAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLD
ELIFATKMAWRNAPRCIGRIQWSNLQVFDARSCSTASEMFQHICRHILYATNSGNIRSAI
TVFPQRSDGKHDFRIWNSQLIRYAGYQMPDGTIRGDPATLEFTQLCIDLGWKPRYGRFDV
LPLVLQAHGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVGGLEF
PACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINAAVLH
SFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEMLNYV
LSPFYYYQIEPWKTHIWQDEKLRPRRREIRFTVLVKAVFFASVLMRKVMASRVRATVLFA
TETGKSEALARDLAALFSYAFNTKVVCMEQYKANTLEEEQLLLVVTSTFGNGDCPSNGQT
LKKSLFMMKELGHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELSG
QEDAFRSWAVQTFRAACETFDVRSKHCIQIPKRYTSNATWEPEQYKLTQSPEPLDLNKAL
SSIHAKNVFTMRLKSLQNLQSEKSSRTTLLVQLTFEGSRGPSYLPGEHLGIFPGNQTGLV
QGILERVVDCSSPDQTVCLEVLDESGSYWVKDKRLPPCSLRQALTYFLDITTPPTQLQLH
KLARFATEETHRQRLEALCQPSEYNDWKFSNNPTFLEVLEEFPSLRVPAAFLLSQLPILK
PRYYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWINNLKPEDPVPCFVRSV
SGFQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHRGLKGGRMTLVFGCRHPEEDHL
YQEEMQEMVRKGVLFQVHTGYSRLPGKPKVYVQDILQKELADEVFSVLHGEQGHLYVCGD
VRMARDVATTLKKLVAAKLNLSEEQVEDYFFQLKSQKRYHEDIFGAVFSYGAKKGNTLEE
PKGTRL
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgcgcgagggtctgagcagcgcttgcgacgccgcccggccgcggctctgtcgcttcctg
cgcaggatctttggcccgaaggtcgccagtcgcgtgggcccagccagcccaacaacacag
gatgaccctaagagtcacaagcatcaaaatggtttcccccagttcctcactgggactgca
cagaatgttccagaatccctggacaagctgcatgtgactccatcgacccgcccacagcac
gtgaggatcaaaaactggggcaatggagagatttttcacgacacccttcaccacaaggcc
acctcggatatctcttgcaagtccaaattatgcatggggtccatcatgaactccaagagt
ttgaccagaggacccagagacaagcccaccccagtggaggagcttctgcctcaagccatt
gaattcattaaccagtattatggctccttcaaagaggcaaaaatagaggaacatctggcc
aggctggaagccgtaacaaaggaaatagaaacaacaggaacctaccagctcactctggat
gagctcatctttgccaccaagatggcctggaggaacgcccctcgctgcatcggcaggatt
cagtggtccaacctgcaggtcttcgatgcccggagctgtagcactgcatcagaaatgttc
cagcatatctgcagacacatactttacgccactaacagtggcaacatcaggtcggccatt
actgtgttcccccagcggagcgatgggaagcatgacttccggatctggaattcccagctc
atccggtacgctggctaccagatgcccgatggcaccatcagaggggatcctgccaccttg
gagttcacccagttgtgcatcgacctgggctggaagccccgctatggccgcttcgatgtg
ctgcctctggtcctgcaggctcacggtcaagatccagaggtctttgaaatccctcctgat
cttgtgctggaggtgaccatggagcatcccaagtacgagtggttccaggagctcgggctg
aagtggtatgcgctgcctgccgtggccaacatgctcctggaggtgggtggcctcgagttc
ccagcctgccccttcaatggttggtacatgggcaccgagattggagtccgagacttctgt
gacacacagcgctacaacatcctggaggaagtgggcaggaggatgggcctggagacccac
acactggcctccctctggaaagaccgggctgtcaccgagatcaatgcagctgtgctccat
agttttcagaagcagaatgtgaccatcatggaccaccacacagcctcagagtccttcatg
aagcacatgcagaatgagtaccgggcccgaggaggctgccctgcagactggatttggctg
gtccctccggtgtccgggagcatcacccctgtgttccaccaggagatgttgaactacgtc
ctatctccattctactactaccagatcgagccctggaagacccacatctggcaggatgag
aagctgaggcccaggaggagagagatccggttcacagtcttggtgaaagcggtgttcttt
gcttctgtgctaatgcggaaggtcatggcttcccgcgtcagagccacagtcctctttgct
actgagacaggaaagtcggaagcgctagccagggacctggctgccttgttcagctacgcc
ttcaacaccaaggttgtctgcatggaacagtataaggcaaacaccttggaagaggaacaa
ctactgctggtggtgacaagcacatttggcaatggagactgccccagcaatgggcagact
ctgaagaaatctctgttcatgatgaaagaactcgggcataccttcaggtatgcggtattt
ggcctgggctccagcatgtaccctcagttctgtgcctttgctcatgacatcgaccagaaa
ctgtctcacctgggagcctcccagcttgccccaaccggagaaggggacgaactcagcggg
caggaggacgccttccgcagctgggctgtgcaaaccttccgggcagcctgtgagacgttc
gatgttcgaagcaaacattgcattcagatcccgaaacgctacacttccaacgcaacatgg
gagccagagcagtacaagctcacccagagcccagagcctctagacctcaacaaagctctc
agcagcatccacgccaagaacgtgttcaccatgaggctgaaatccctccagaatctgcag
agtgagaagtccagccgcaccaccctccttgttcaactcaccttcgagggcagccgaggc
cccagctacctacctggggaacacctggggattttcccaggcaaccagacgggcctggtg
caagggatcttggagcgagttgtggattgttcttcgccagaccaaactgtgtgcctggag
gttctagatgagagtggcagctactgggtcaaagacaagaggcttcccccctgctcactc
aggcaagccctcacctacttcctggacatcactacccctcccacccagctgcagctccac
aagctggcccgctttgccacggaagagacgcacaggcagaggttggaggccttgtgtcag
ccctcagagtacaacgattggaagttcagcaacaaccccacgttcctggaggtgctggaa
gagttcccatcattgcgtgtgcctgctgccttcctgctgtcgcagctccccattctgaag
ccccgctactactccatcagctcctcccaggaccacaccccctcggaggtccacctcact
gtggctgtggtcacctatcgcacccgagatggtcagggtcccctgcaccatggcgtctgc
agcacttggatcaataacctgaagcccgaagacccagtgccctgctttgtgcggagtgtc
agtggcttccagctccctgaggacccctcccagccctgcatcctcattgggcccggtaca
ggcattgcccccttccgaagtttctggcagcagcggctccatgactctcagcacagaggg
ctcaaaggaggccgcatgaccttggtgtttgggtgcaggcacccagaggaggaccacctc
tatcaggaagaaatgcaggagatggtccgcaagggagtgttgttccaggtgcacacaggc
tactcccggctgcccggaaaacccaaggtctacgttcaagacatcctgcagaaagagctg
gccgacgaggtgttcagcgtgctccacggggagcagggccacctctatgtttgtggcgat
gtgcgcatggctcgggatgtggctaccactttgaagaagctggtggccgccaagctgaac
ttgagtgaggagcaggttgaggattacttcttccagctcaagagccagaaacgttatcat
gaggatatcttcggtgcggtcttttcctatggagcaaaaaagggcaacaccttggaggag
cccaaaggcacaagactctga

DBGET integrated database retrieval system