KEGG   Schistosoma haematobium: MS3_00508Help
Entry
MS3_00508         CDS       T05004                                 

Definition
(RefSeq) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
shx  Schistosoma haematobium
Pathway
shx00020  Citrate cycle (TCA cycle)
shx00190  Oxidative phosphorylation
shx01100  Metabolic pathways
shx01200  Carbon metabolism
Module
shx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shx_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:shx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MS3_00508
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MS3_00508
Enzymes [BR:shx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MS3_00508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 24588326
NCBI-ProteinID: XP_012792153
UniProt: A0A094ZF21
LinkDB All DBs
Position
Unknown
AA seq 671 aa AA seqDB search
MVHLALSPNAIRKATKLNRLTNLYQSFKCRNLSYTSGYTIIDHSFDAVVVGAGGAGLRAG
FGLANEGFKTAIITKLFPTRSHTVAAQGGINAALGNMEPDDWRFHMYDTVKGSDWLGDQD
AIHYMCEEAPQAVIELENYGVPFSRLENGKIYQRAFGGQSIDYGRGGQAHRCCAVADRTG
HSLLHTLYGRSLRYDATYFIEYFVLDLLMENGECRGVIAVCLEDGTLHRFRSKNTVLATG
YVVFLSSYQIGVMVVHTFPVLQHILVPVMGRQWSHGLGCLIKTWSLFSFIPQVSADISCN
FKGIYGAGCLITEGCRGEGGYLINSKGERFMERYAPNAKDLASRDVVSRAMTIEIREGRG
VGSRKDHIFLQLSHLPADQLHSRLPGISETAKIFAGIDVTRDPIPVLPTVHYNMGGIPTN
YKGQVLTYDPVAKKDKVVPGLYAAGEAACASVHGANRLGANSLLDIVVFGRACALDISAK
NKPGDAGPELKPDTGEVSIANYEKLRTANGNYPIAQVRLEMQRTMQEYAAVFRDGPTLKE
GCRKMYELYASRMNDLKVSDRSKIWNSDLMEALELQNLMLNALQTIVGAEARRESRGAHA
REDFPNRLDEFDYSQPIDGQKPKPFEEHWRKHTLSYQDVKTGAVKLEYRPVIDTTLDSKS
CPTVPPKLRTY
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctggcactttctccaaatgccatccgtaaagctacaaagttgaaccgtttg
accaacttataccagtcttttaaatgtcgaaacctaagttacactagcggatacactatt
attgaccattcattcgatgcggtggttgttggtgcaggtggggcgggtttacgtgcaggt
tttggcctcgcaaatgagggtttcaaaactgcaattataacaaaattatttcctaccaga
tctcacacagttgctgctcagggtggaataaatgctgctcttgggaatatggagcctgat
gactggcgtttccatatgtatgatacagtcaaaggttccgattggttaggcgaccaggat
gctattcattacatgtgtgaagaggccccacaagccgttatcgagttggaaaactatgga
gtaccttttagtcgcttggagaacggcaaaatataccagcgagcatttggtggtcaaagc
atagactatgggcgcggcggtcaggcccatcgctgttgtgcagttgcggatcgaactggg
cattcacttttgcatacattatatggccggtcattacgttatgacgccacttatttcatt
gaatatttcgtattggatcttctcatggaaaatggcgagtgtcgtggtgtcattgctgtg
tgtttagaggatgggactttgcatcgtttccgttctaaaaatacagttctcgctacaggg
tatgtcgtttttcttagctcttatcagataggggttatggtcgtacatacttttcctgta
cttcagcacatacttgtaccggtgatgggacggcaatggtcacacgggctgggttgccta
atcaagacatggagtttgttcagtttcatcccacaggtaagtgcggatatatcctgtaac
ttcaaaggaatttatggggctgggtgcttaatcaccgagggctgtcgaggtgagggtggt
tacctcattaatagtaaaggagagagatttatggagagatatgctcctaatgctaaagat
ctagcttctcgggacgttgtgtcaagagcaatgacaattgagattcgcgaaggacgagga
gttggctctaggaaagaccacatatttttgcaactttctcatcttccggcagaccaacta
cacagtcgacttcctggtatatcggagacagcaaaaatattcgcaggtattgatgttaca
agggatcctattcctgtgttacctaccgtccactataatatggggggaattcctacaaac
tataaaggacaggtgctgacttatgatccggttgctaagaaagataaggttgttcctgga
ctatatgctgctggtgaagctgcttgtgcatcggttcacggcgctaatagactaggtgcc
aactcactacttgacatagttgtgtttggtcgtgcatgtgcgcttgacatttctgcgaaa
aataagcctggagacgcaggtccagagttaaaaccagataccggggaggtctccatcgct
aactatgaaaaactccggaccgcaaatggaaattatccaattgcacaagttcgattagaa
atgcagcgaacaatgcaagagtatgctgcagtatttcgtgatggtcctactctcaaagag
ggctgtagaaaaatgtatgaattatatgcttctcgaatgaatgatttaaaagttagtgat
cgcagcaaaatatggaatagcgatctaatggaagcattagaattacagaatctgatgcta
aacgctttacagactattgttggagctgaagcccgtagagaatcgcgtggtgctcatgca
cgtgaagactttcctaatcgattagatgaattcgactactcccaacctattgatggacaa
aagcctaagccatttgaagaacattggcgaaaacatactctgtcttatcaggatgttaaa
acgggtgctgtaaaattggaatatcgtcctgtaattgataccaccttggattctaagagc
tgtccaactgtccctccaaaactacgcacttattag

DBGET integrated database retrieval system