KEGG   Ursus arctos horribilis: 113260761
Entry
113260761         CDS       T05909                                 

Gene name
CCL28
Definition
(RefSeq) C-C motif chemokine 28
  KO
K05513  C-C motif chemokine 28
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260761 (CCL28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113260761 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    113260761 (CCL28)
   04062 Chemokine signaling pathway
    113260761 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260761 (CCL28)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113260761 (CCL28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113260761
NCBI-ProteinID: XP_026362392
UniProt: A0A3Q7XIR9
LinkDB
Position
Unknown
AA seq 124 aa
MASPGELLDVRICRPHPRSILPIASSCCTEVSHHISRRLLERVNLCRIQKADGDCDLAAV
ILHIRRRRICVSPHSHVIKQWMKEQAAKKNAKGNMCHKKKHAGQRKSKGAHPGKPETQAH
KTPY
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcatcacctggggagttgttagatgtgcgcatttgcaggcctcatcccagatccata
cttcccattgcctccagctgttgcactgaagtttcacatcatatctccagaaggcttctg
gagagagtgaatctatgtcgcatccagaaagctgatggcgattgtgacttggctgctgtc
atccttcacatcaggcgcagaagaatctgtgtcagcccgcacagtcacgttattaagcag
tggatgaaagaacaagcagccaagaaaaacgctaaaggcaacatgtgccacaagaagaaa
cacgccggccagaggaaaagtaaaggggcacatccggggaaaccagaaacccaggcccat
aaaactccttattag

DBGET integrated database retrieval system