KEGG   Aspergillus nidulans: AN2622.2
Entry
AN2622.2          CDS       T01016                                 

Definition
(RefSeq) IPNS_EMENI Isopenicillin N synthetase (IPNS) (Isopenicillin N synthase)
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00311  Penicillin and cephalosporin biosynthesis
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
Module
ani_M00672  Penicillin biosynthesis, aminoadipate + cycteine + valine => penicillin
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AN2622.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     AN2622.2
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy DUF1674
Other DBs
NCBI-GeneID: 2874542
NCBI-ProteinID: XP_660226
UniProt: P05326
LinkDB
Structure
PDB: 

Position
VI
AA seq 331 aa
MGSVSKANVPKIDVSPLFGDDQAAKMRVAQQIDAASRDTGFFYAVNHGINVQRLSQKTKE
FHMSITPEEKWDLAIRAYNKEHQDQVRAGYYLSIPGKKAVESFCYLNPNFTPDHPRIQAK
TPTHEVNVWPDETKHPGFQDFAEQYYWDVFGLSSALLKGYALALGKEENFFARHFKPDDT
LASVVLIRYPYLDPYPEAAIKTAADGTKLSFEWHEDVSLITVLYQSNVQNLQVETAAGYQ
DIEADDTGYLINCGSYMAHLTNNYYKAPIHRVKWVNAERQSLPFFVNLGYDSVIDPFDPR
EPNGKSDREPLSYGDYLQNGLVSLINKNGQT
NT seq 996 nt   +upstreamnt  +downstreamnt
atgggttcagtcagcaaagccaatgttccaaagatcgatgtttctcccctgtttggagac
gaccaagcagccaaaatgagagtagcccagcaaatcgacgccgcttcgcgtgatactggg
tttttctacgccgtcaaccatgggatcaatgtgcagcgactctcgcagaagaccaaggag
tttcatatgtctatcacacctgaggaaaagtgggaccttgcgattcgtgcctacaacaaa
gagcaccaggaccaagtccgtgccggatactacctgtccatccccgggaaaaaggcagtc
gagtccttctgctaccttaacccgaacttcacgcccgatcatccccgtatccaggccaag
actcccactcacgaggtaaacgtgtggccagacgagaccaagcaccctggtttccaagac
tttgccgagcagtattactgggatgttttcggtctctcttctgcactgctcaagggctac
gccttggcattaggcaaagaggagaatttcttcgctcgccacttcaagccagacgatact
cttgcctcggttgtgctgatccgctacccttacctggatccctaccccgaggctgctatc
aagacggcggccgacggcaccaaactgagttttgagtggcatgaggatgtatccctaatc
actgtgctttaccagtccaacgtgcagaacctgcaggtagaaactgctgccgggtatcaa
gatatcgaggccgacgatactggctacttgatcaactgcggcagttacatggcacatctc
acaaacaactactataaagcgcccatccatcgggtgaaatgggttaatgcagagcgccag
tccctgccattcttcgtcaacctgggatacgacagcgtgattgatccatttgatccccga
gaacccaatggcaagtctgatcgggagccactctcctacggcgactatttgcaaaacggg
ctggtgagtttgatcaacaagaacggccagacctag

DBGET integrated database retrieval system