KEGG   Cyprinus carpio (common carp): 109109845
Entry
109109845         CDS       T05134                                 
Symbol
mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ccar  Cyprinus carpio (common carp)
SSDB
Motif
Pfam: MRAP TAS2R LapA_dom
Other DBs
NCBI-GeneID: 109109845
NCBI-ProteinID: XP_018978404
LinkDB
Position
36:380137..381264
AA seq 91 aa
MKNSTKPSEYVWDYEYYYDYIDPVSVNASTLKYNRYSIVIIFWIILAAFIGFFFLILSLI
SHSRQLQRGPHVQKSGLPLMKNYGSPQKRNK
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaagaactccacaaagccgtcagaatatgtgtgggattacgagtactactacgattac
atcgatccggtctccgtgaatgccagtacactgaagtacaacagatattcaattgtcata
atattctggatcattctagctgcatttattgggtttttcttcttgattctgtcacttata
tcacactcaaggcaacttcagaggggccctcatgtccaaaaatctggcttgccattgatg
aaaaactatggatctcctcagaaaagaaacaaataa

DBGET integrated database retrieval system