KEGG   Yamadazyma tenuis: CANTEDRAFT_133210
Entry
CANTEDRAFT_133210 CDS       T03099                                 
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
cten  Yamadazyma tenuis
Pathway
cten04111  Cell cycle - yeast
cten04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cten00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CANTEDRAFT_133210
   04113 Meiosis - yeast
    CANTEDRAFT_133210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cten03400]
    CANTEDRAFT_133210
DNA repair and recombination proteins [BR:cten03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    CANTEDRAFT_133210
SSDB
Motif
Pfam: Rad9 MupG_N DUF2474
Other DBs
NCBI-GeneID: 18249678
NCBI-ProteinID: XP_006684363
JGI: Cante1_133210
UniProt: G3AY86
LinkDB
Position
Unknown
AA seq 401 aa
MSFVAHLAQERHLLLWAKSVLALTLVSDDIKFVISEKSITISAVNSTNTSDGDISFERDF
FDEYHVSFDGTISHGFDIEDATYSFIVSSNHLSILFKTLDTDSLIKLRVNFDNEFRMLID
ITRKLIVKKYQIGYQPVKNQHDPVWKYYVSEHQRQQNILPTCHDSDIKYIRIDHKILKEF
VDLVPQQTEEFKIEVKSNKISFNGFTKMILKDNQYLKQPMSITISLNLYELADTNMPPEF
NQRINFKLKFFKIFINLISFISLHKLDQSEEFEIYFKAPGDPVLFTLRSTRHVCVHFVQL
TNDEAGQTENLITQNPIMKSYKLEEVGRNSSKYATGALTHSTSRSTISRPNLLNPAKELT
GDNGSYSDLEPEVDQFNVNFDDESEVELGATQHDEVRSIFD
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgtcgtttgttgctcatttagcacaagaaaggcatctacttctatgggctaagtctgtc
ttggctctaactttggttagtgacgatatcaagtttgtgatcagtgaaaagtccattacc
atctcagcagtaaattcaactaataccagtgatggagacatctcgtttgaaagggacttc
tttgacgagtatcacgtatcttttgatggtacaatttcgcatggattcgatatagaagat
gccacatacctgtttattgtcagttccaaccacttatcaatccttttcaaaactttggat
acggacagcttgataaaactacgtgtcaactttgacaatgaattccgtatgctcattgac
atcaccagaaagctcattgtaaagaagtatcaaatcggttatcagccagtgaaaaaccaa
cacgatcccgtatggaaatattatgtgtcagaacaccagcgccagcaaaatattttacca
acttgccatgattcggacataaagtacattagaattgaccacaagatattgaaggagttt
gttgacttggttccacaacaaactgaagaattcaagatcgaagtcaagagcaacaagatc
agtttcaacggctttaccaaaatgattttgaaagataaccaatatctcaaacagccaatg
tcaatcaccatttcactcaacttgtacgaacttgctgataccaacatgccaccagagttt
aaccagaggattaattttaaattgaagttcttcaagattttcataaatcttattagcttt
atcctgctccataagcttgatcaaagcgaggaattcgaaatctacttcaaggctcctggg
gaccctgttttatttaccttgagaagtactcgccatgtatgtgtgcactttgttcaactc
acaaatgatgaagccggtcaaaccgagaacctaatcacccaaaacccaatcatgaaaagt
tataagcttgaggaagtaggtaggaactccctgaaatatgccacaggagctttgacccat
ctgactagtcgctcaactatttcaaggccaaatttactaaatccggcaaaagaattaacc
ggtgataacggctcatactccgatcttgagcctgaagtcgaccaattcaatgtaaacttc
gatgatgagtcggaggtggagctaggagccactcaacatgatgaggtccgttccatattt
gattga

DBGET integrated database retrieval system