KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs1815
Entry
ECs1815           CDS       T00048                                 

Definition
(RefSeq) hypothetical protein
  KO
K23658  T3SS secreted effector NleF
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs1815
SSDB
Motif
Pfam: NleF_casp_inhib DUF4468
Other DBs
NCBI-GeneID: 912903
NCBI-ProteinID: NP_309842
UniProt: Q8XAL7
LinkDB
Structure
PDB: 
3V3K

Position
1805670..1806239
AA seq 189 aa
MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLSPELQDKLDVMVSIYSCARNNN
ELEEIFQELSAFVSGLMDKRNSVFEVRNENTDEVVGALRAGMTIEDRDSYIRDLFFLHSL
KVKIEESRQGKEDSKCKVYNLLCPHHSSELYGDLRAMKCLVEGCSDDFNPFDIIRVPDLT
YNKGSLQCG
NT seq 570 nt   +upstreamnt  +downstreamnt
atgttaccaacaagtggttcttcagcaaatctttattcatggatgtatgtatcaggaaga
ggtaacccttcgactccggaatcagtaagtgagcttaatcataatcactttctttctcct
gaattacaagataaacttgatgttatggtctctatatattcatgtgccagaaataataat
gagcttgaggaaatttttcaagagctaagtgcttttgtaagtgggctgatggataagaga
aatagtgtatttgaggtgagaaatgaaaatactgatgaggttgtcggagcgctgagggcg
ggaatgacgatagaggacagggatagttatatcagggatcttttttttctgcattcattg
aaagtaaaaattgaggaaagtagacaaggcaaagaagattcgaaatgtaaagtttataat
ctgctatgtccgcatcactcttcagagctatatggtgatctacgagcaatgaaatgcctc
gtggaaggatgcagtgatgattttaatccttttgatattattagggtaccagatcttact
tacaacaaaggatctttacaatgtggatga

DBGET integrated database retrieval system