KEGG   Felis catus (domestic cat): 101083750
Entry
101083750         CDS       T02385                                 
Symbol
XCR1
Name
(RefSeq) chemokine XC receptor 1
  KO
K04193  XC chemokine receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101083750 (XCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101083750 (XCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101083750 (XCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101083750 (XCR1)
   04050 Cytokine receptors [BR:fca04050]
    101083750 (XCR1)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   C Chemokine
    101083750 (XCR1)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  C Chemokine
   101083750 (XCR1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 101083750
NCBI-ProteinID: XP_023103859
Ensembl: ENSFCAG00000006827
LinkDB
Position
A2:complement(15717673..15722269)
AA seq 331 aa
MEPSGIPESTTPFEYDDQSFLCESKNFAFATLSTTILYFLVFLLSLVGNSLVLWVLVKFE
SLESLTNVFILNLCLSDVAFSFLLPVWILGYHWGWVLGDFLCKLLNMIFSISLYSSIFFL
TIMTVHRYVSVVRPLSSMRVHTLQCRVLVTAAVWATSILSSIIDAIFHKVFPSGCNYSEV
RWFIASVYQHNIIFLLSVGIILFCYVEILRTLFRSRSKRHHRTVRLIFTIVVVYFLSWAP
YNLILFLQTLLKLSVIQSCEFIQQLDYALLICRNVAFSHCCFNPVLYVFVGVKFRRHLKS
LVRHFWLCRQQASSIPPHTLGTFNYEGASFF
NT seq 996 nt   +upstreamnt  +downstreamnt
atggagccctcaggcatcccagagtccaccactccttttgagtatgacgatcagagcttt
ctgtgtgagagcaagaacttcgcctttgccaccctcagcaccaccatcctgtacttcctg
gtgtttctcctcagcctggtgggcaacagcctggtgttgtgggtcctggtgaagtttgag
agcctggagtccctcaccaacgtctttatcctcaacctgtgcctctcagacgtggccttc
tccttcttgttgccggtgtggatcctggggtaccactggggctgggtgctgggggacttc
ctctgcaagctcctcaacatgatcttctccatcagcctctacagcagcatcttcttcttg
accatcatgaccgtccaccgctacgtgtcggtggtgaggcccctctcgtccatgcgcgtc
cacaccctccagtgccgcgtgctggtgaccgcggccgtgtgggcgaccagcatcctgtcc
tcaatcatcgatgccatcttccacaaggtgtttccttcgggctgcaactattcggaagtc
agatggttcatagcctcggtctaccagcacaacatcatcttcctgctctccgtcgggatc
atcctgttctgctacgtggagattctcaggaccctgttccgctcgcggtccaaacggcac
caccggacggtccggctcatcttcaccatcgtggtggtgtacttcctcagctgggctccc
tacaacctgatcctgtttctacagacactgctgaaactcagcgtcatccagagctgcgag
ttcatccagcagctggattacgccttgctcatctgccgcaacgtcgccttctcccactgc
tgcttcaacccggtgctctacgtctttgtcggggtcaagttccgcaggcatctcaaaagt
ctggtccggcacttctggctctgtcggcagcaggcgtccagcatcccccctcacaccctg
ggcaccttcaactatgagggcgcctccttcttttga

DBGET integrated database retrieval system