KEGG   Metarhizium acridum: MAC_05732
Entry
MAC_05732         CDS       T03104                                 
Name
(RefSeq) cytochrome P450
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
maw  Metarhizium acridum
Pathway
maw00910  Nitrogen metabolism
maw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MAC_05732
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:maw00199]
    MAC_05732
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     MAC_05732
Cytochrome P450 [BR:maw00199]
 Cytochrome P450, fungi type
  CYP55 family
   MAC_05732
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 19250043
NCBI-ProteinID: XP_007812072
UniProt: E9E784
LinkDB
Position
Unknown
AA seq 438 aa
MEPPAEYARLRATDPVSRVELFDGSLAWLVTKYKDVTLVATDNRLSKVRTRPGFPELSAG
GKEAAKAKPTFVDMDPPEHMKYRHVKRPVHNFHCLIPSYRSMVNYFFTPEYIKSLQPYIQ
KTVDDLLDALKAKGCASGPVDLVKEFALPVPSFIIYSILGVPFEDLQFLTEQNAIRTNGS
ASAREASAASKYEPLDTGLLEYLEELVDLRTAAPKDDLISKLVVEQMIPGHISKADVVQN
AFLLLVAGNATMVNMIALGVVTLFQHPAQLAELKADPSLAPAFVEELCRYHTASAMAIKR
TAITDIEIGGKVLIKAGEGVIASNQSANRDEEIFTRPDEFDMHRKWPSQDPLGFGFGEHR
CIAEGLAKAELTTVFCKFSFPEEPIAKRIWHGGVLTSLLLPATLFQQLPNLKLAVPISDI
KYTPLHKDVGIQELPVTF
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggagcctcccgccgagtatgctcgtctacgggctactgatccggtgtcgagggttgag
ctctttgacgggagtctcgcttggctagtaaccaagtacaaagatgtgaccttagttgcc
acggataataggctgtccaaggttaggactcgtccaggtttcccagagctgagcgctggt
ggcaaagaggcggcaaaggccaaaccgacttttgtcgacatggatccccccgagcacatg
aaatataggcatgttaaacgtccagtgcacaatttccactgtctaataccctcttatagg
agcatggtgaactacttcttcacccctgagtatatcaagtcgttgcagccatatatccag
aagacggtggatgacctcctcgatgcgctcaaagccaaagggtgtgcctctgggcccgtt
gacttggtcaaggaattcgcacttccagtgccatcatttatcatctacagtattcttgga
gtcccgtttgaagaccttcagtttctcacggaacaaaatgctatccgaaccaatggcagt
gcatccgcgagagaggcatcggccgctagcaagtatgagccattggacacgggacttctc
gagtatctcgaagagctggtcgatctgcggactgcggccccgaaggacgacctcatcagc
aagctggtagtggagcaaatgattcccggacacatctccaaggccgatgttgttcagaat
gcgttcctgcttctcgttgcagggaatgcgaccatggtgaacatgatagcgctcggcgtc
gtgacacttttccagcacccggctcaactcgccgagctgaaggccgatccatcactcgca
cctgcatttgtggaagagctgtgtcgctatcacactgcctctgccatggccattaagcgc
acagctataacggacattgagatcgggggaaaggtactcataaaggcgggcgaaggcgtc
atcgcgtcgaaccaatcagccaatcgagacgaagagatatttacacgcccggacgagttc
gatatgcaccggaagtggccgagccaagatccgctcggttttggcttcggcgagcatcga
tgcatcgcagagggtctggccaaggcggagctgacgaccgtgttctgtaagttttccttc
ccagaagaaccaatcgccaagagaatatggcatggaggggtgctaacaagtttactacta
ccagcgactctgttccagcagctgccaaatctcaagcttgccgtgcccatttctgacatc
aagtatacacctctacacaaggacgttggcatccaagaattacctgttacattttaa

DBGET integrated database retrieval system